Property Summary

NCBI Gene PubMed Count 84
PubMed Score 90.17
PubTator Score 70.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.1e-06
psoriasis 6685 3.1e-05
Disease Target Count Z-score Confidence
Cancer 2346 3.55 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.900 3.1e-05
ovarian cancer -1.100 1.1e-06

Protein-protein Interaction (10)

Gene RIF (40)

PMID Text
26475675 The release of extracellular vesicles was triggered by TNFA from BEAS-2b cells.TNFA-triggered extracellular vesicles contained TNFR1 and TRADD.
25791120 NPM-RAR binding to TRADD selectively inhibits caspase activation, while allowing activation of NFkappaB and JNK
25732226 MicroRNA-30c-2-3p negatively regulates NF-kappaB signaling and cell cycle progression through downregulation of TRADD and CCNE1 in breast cancer.
25643035 domains of calmodulin mediate FADD and TRADD interaction
25230327 PA induced the apoptosis of HUVECs by initiating the death pathway (TNF-R1/TRADD/caspases 8 pathway), whereas AA enhanced cell survival to protect vascular endothelial cells by activating the survival pathway (TNF-R1/RIP/NF-kappaB 50/NF-kappaB 65).
25033841 Biologic assessment found that NPM-RAR expression impaired TNF-induced signaling through TRADD, blunting TNF-mediated activation of caspase-3 (CASP3) and caspase-8 (CASP8), to ultimately block apoptosis.
24374337 we demonstrated that the association between DR6 and TRADD was enhanced upon DQM3 stimulation and TRADD was involved in DR6-induced signaling activation
24361886 structure-based mutations of TNFR-1 (P367A and P368A), TRADD (F266A), and RIP1 (M637A and R638A) disrupted formation of the death domain (DD) complex and prevented stable interactions among those DDs
24070137 TRADD gene expression was knocked down by an antisense oligonucleotide.
23982205 Data indicate that the ASK1-FoxO3a-TRADD-caspase 8 pathway is present in neural tube defects (NTDs)-affected tissues.
23955153 death domains in several proteins, including TRADD, FADD, RIPK1 and TNFR1, were directly inactivated by NleB, an enteropathogenic Escherichia coli (EPEC) type III secretion system effector known to inhibit host nuclear factor-kappaB (NF-kappaB) signalling
23908590 Data indicate that silencing tumor necrosis factor receptor 1 (TNFR1)-associated death domain protein (TRADD) in glioma cells results in decreased NF-kappaB activity, decreased proliferation of cells, and increased sensitivity to temozolomide.
22510408 rpS3 appears to be recruited to the death-inducing signaling complex (DISC) to induce apoptosis by interacting TRADD in response to extracellular stresses.
22170762 NSP 5a3a induces apoptosis in Head and Neck cell line HN30 through p73-DAXX and TRAF2-TRADD.
21724995 Death domain SXXE/D motifs are phosphorylated, as is required for stable TNFR1-TRADD complex formation and subsequent activation of NF-kappaB in inflamed mucosa.
21068102 Observational study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
19854717 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19151112 glomerular and tubular expression of TNF-alpha, (TNF receptor-associated death domain protein)TRADD, RIP(receptor-interacting protein) and TRAF-2 (TNF receptor-associated factor-) was significantly up-regulated in Lupus nephritis
18990758 Observational study of gene-disease association. (HuGE Navigator)
18661484 Mutations in the TRADD gene may contribute to the development of different hematological diseases.
18198944 unique interaction of LMP1 with TRADD encodes the transforming phenotype of viral TRADD signaling and masks TRADD's pro-apoptotic function
18174230 Observational study of gene-disease association. (HuGE Navigator)
17922260 The structure of TRADD DD was solved by NMR.
17235653 The expression of TRADD in peripheral blood mononuclear cells was significantly decreased in SLE patients.
17051333 These findings suggest that EMAP-II sensitises endothelial cells to apoptosis by facilitating TNF-R1 apoptotic signalling via TRADD mobilization.
16611992 TRADD and RIP1 compete for recruitment to the TNFR1 signaling complex and the distinct programs of cell death.
16227624 PAK4 has a role in TNF-alpha induced cell survival pathyways by facilitating TRADD binding to the TNF Receptor
16006552 TRADD employs a Pelle-like surface to interact with its binding partners, either receptor TNFR1 or adaptor FADD.
15761471 TRADD activates distinct mechanisms of apoptosis from the nucleus and the cytoplasm.
15103018 The mRNA expression levels for alpha-tubulin, TRADD, IFN-gamma R2, GAS1, MADD, NF-kappaB, I-kappa B, 14-3-3 protein, APaf1, PARP, IGF-1 receptor, RB1, Rb2/p130, ARC, and caspase 6 are upregulated in human neuronal cells after treatment with HIV-1 gp120
14660619 TRAD binds with keratin 14 and has a role in susceptibility of keratinocytes to caspase-8-mediated apoptosis
12604596 TRADD is involved in the p75(NTR)-mediated antiapoptotic activity of nerve growth factor in breast cancer cells
12576460 Diphtheria toxins induce apoptosis by activating components of the death receptor pathway in a receptor-independent manner.
12446787 chemotherapeutic drugs exhibited their cytotoxic effects in part by down-regulating Akt signaling following TRADD expression
12045187 TRADD contains a nuclear export and import sequence that allows shuttling between the nucleus and the cytoplasm. It induces apoptosis via different mechanisms.

AA Sequence

MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQ      1 - 70
LIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCIL     71 - 140
AQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVV    141 - 210
NRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRA    211 - 280
TLQRLVEALEENELTSLAEDLLGLTDPNGGLA                                          281 - 312
//

Text Mined References (86)

PMID Year Title
26475675 2015 TNF? triggers release of extracellular vesicles containing TNFR1 and TRADD, which can modulate TNF? responses of the parental cells.
25791120 2015 NPM-RAR binding to TRADD selectively inhibits caspase activation, while allowing activation of NF?B and JNK.
25732226 2015 MicroRNA-30c-2-3p negatively regulates NF-?B signaling and cell cycle progression through downregulation of TRADD and CCNE1 in breast cancer.
25643035 2015 N-terminal and C-terminal domains of calmodulin mediate FADD and TRADD interaction.
25230327 2015 Life and death of human vascular endothelial cells by stimulation with free fatty acids through death receptors.
25033841 2014 Extrinsic apoptosis is impeded by direct binding of the APL fusion protein NPM-RAR to TRADD.
24374337 2014 Agonist antibody activates death receptor 6 downstream signaling involving TRADD recruitment.
24361886 2014 Death domain complex of the TNFR-1, TRADD, and RIP1 proteins for death-inducing signaling.
24070137 2013 Anticancer activity of an antisense oligonucleotide targeting TRADD combined with proteasome inhibitors in chemoresistant hepatocellular carcinoma cells.
23982205 2013 Maternal hyperglycemia activates an ASK1-FoxO3a-caspase 8 pathway that leads to embryonic neural tube defects.
23955153 2013 Pathogen blocks host death receptor signalling by arginine GlcNAcylation of death domains.
23908590 2013 Cytoplasmic TRADD confers a worse prognosis in glioblastoma.
23429285 2013 EVER2 protein binds TRADD to promote TNF-?-induced apoptosis.
22510408 2012 Ribosomal protein S3 interacts with TRADD to induce apoptosis through caspase dependent JNK activation.
22333735 2012 The role of TRADD in death receptor signaling.
22170762 2011 A novel dual signaling axis for NSP 5a3a induced apoptosis in head and neck carcinoma.
21724995 2011 Phospho-SXXE/D motif mediated TNF receptor 1-TRADD death domain complex formation for T cell activation and migration.
21269460 2011 Initial characterization of the human central proteome.
21068102 2011 Association of STAT3 and TNFRSF1A with ankylosing spondylitis in Han Chinese.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
19854717 2010 The chromosome 16q region associated with ankylosing spondylitis includes the candidate gene tumour necrosis factor receptor type 1-associated death domain (TRADD).
19781631 2010 Proteinase-activated receptor-2 mediated inhibition of TNFalpha-stimulated JNK activation - A novel paradigm for G(q/11) linked GPCRs.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19524513 2009 Phosphorylation-driven assembly of the RIP1-RIP3 complex regulates programmed necrosis and virus-induced inflammation.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19151112 2009 Up-regulated renal expression of TNF-alpha signalling adapter proteins in lupus glomerulonephritis.
18990758 2008 Genetic variation in tumor necrosis factor and the nuclear factor-kappaB canonical pathway and risk of non-Hodgkin's lymphoma.
18661484 2008 Screening, identification, and functional analysis of three novel missense mutations in the TRADD gene in children with ALL and ALPS.
18309324 2008 No death without life: vital functions of apoptotic effectors.
18198944 2008 The viral oncoprotein LMP1 exploits TRADD for signaling by masking its apoptotic activity.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
17922260 2007 The NMR structure of the TRADD death domain, a key protein in the TNF signaling pathway.
17235653 2007 Decreased expressions of the TNF-alpha signaling adapters in peripheral blood mononuclear cells (PBMCs) are correlated with disease activity in patients with systemic lupus erythematosus.
17051333 2006 EMAP-II facilitates TNF-R1 apoptotic signalling in endothelial cells and induces TRADD mobilization.
16611992 2006 Competitive control of independent programs of tumor necrosis factor receptor-induced cell death by TRADD and RIP1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16227624 2005 PAK4 functions in tumor necrosis factor (TNF) alpha-induced survival pathways by facilitating TRADD binding to the TNF receptor.
16006552 2005 A mechanism for death receptor discrimination by death adaptors.
15761471 2005 The adaptor protein TRADD activates distinct mechanisms of apoptosis from the nucleus and the cytoplasm.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15310755 2004 AIP1/DAB2IP, a novel member of the Ras-GAP family, transduces TRAF2-induced ASK1-JNK activation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660619 2004 An autocrine/paracrine loop linking keratin 14 aggregates to tumor necrosis factor alpha-mediated cytotoxicity in a keratinocyte model of epidermolysis bullosa simplex.
14644197 2003 Mechanisms of caspase activation.
14585990 2003 TRUSS, a novel tumor necrosis factor receptor 1 scaffolding protein that mediates activation of the transcription factor NF-kappaB.
12911633 2003 Expression of death-associated protein kinase and recruitment to the tumor necrosis factor signaling pathway following brief seizures.
12887920 2003 Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12604596 2003 Tumor necrosis factor receptor-associated death domain protein is involved in the neurotrophin receptor-mediated antiapoptotic activity of nerve growth factor in breast cancer cells.
12576460 2003 Apoptosis by leukemia cell-targeted diphtheria toxin occurs via receptor-independent activation of Fas-associated death domain protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446787 2002 Involvement of FKHR-dependent TRADD expression in chemotherapeutic drug-induced apoptosis.
12417987 2002 A missense mutation (R565W) in cirhin (FLJ14728) in North American Indian childhood cirrhosis.
12045187 2002 Nuclear and cytoplasmic shuttling of TRADD induces apoptosis via different mechanisms.
11684708 2001 Keratin attenuates tumor necrosis factor-induced cytotoxicity through association with TRADD.
11435712 2001 Assignment of TRADD to human chromosome band 16q22 by in situ hybridization.
11374864 2001 Hepatitis C virus core protein potentiates TNF-alpha-induced NF-kappaB activation through TRAF2-IKKbeta-dependent pathway.
11112773 2001 Caveolin-1 associates with TRAF2 to form a complex that is recruited to tumor necrosis factor receptors.
11112409 2000 Interaction of Daxx, a Fas binding protein, with sentrin and Ubc9.
11032752 2000 The serine/threonine kinase HIPK2 interacts with TRADD, but not with CD95 or TNF-R1 in 293T cells.
10911999 2000 Solution structure of N-TRADD and characterization of the interaction of N-TRADD and C-TRAF2, a key step in the TNFR1 signaling pathway.
10892748 2000 A novel mechanism of TRAF signaling revealed by structural and functional analyses of the TRADD-TRAF2 interaction.
10848577 2000 Stat1 as a component of tumor necrosis factor alpha receptor 1-TRADD signaling complex to inhibit NF-kappaB activation.
10400625 1999 c-E10 is a caspase-recruiting domain-containing protein that interacts with components of death receptors signaling pathway and activates nuclear factor-kappaB.
10356400 1999 The interaction of p62 with RIP links the atypical PKCs to NF-kappaB activation.
10187805 1999 Inhibition of receptor internalization by monodansylcadaverine selectively blocks p55 tumor necrosis factor receptor death domain signaling.
9916988 1998 Modulation of life and death by the TNF receptor superfamily.
9916731 1999 TNF recruits TRADD to the plasma membrane but not the trans-Golgi network, the principal subcellular location of TNF-R1.
9714541 1998 Identification and functional characterization of DR6, a novel death domain-containing TNF receptor.
9430227 1997 Death receptor 5, a new member of the TNFR family, and DR4 induce FADD-dependent apoptosis and activate the NF-kappaB pathway.
9427646 1998 Dominant-negative FADD inhibits TNFR60-, Fas/Apo1- and TRAIL-R/Apo2-mediated cell death but not gene induction.
9356494 1997 The Epstein-Barr virus oncogene product latent membrane protein 1 engages the tumor necrosis factor receptor-associated death domain protein to mediate B lymphocyte growth transformation and activate NF-kappaB.
8943045 1996 The tumor necrosis factor receptor 2 signal transducers TRAF2 and c-IAP1 are components of the tumor necrosis factor receptor 1 signaling complex.
8934525 1996 A death-domain-containing receptor that mediates apoptosis.
8702708 1996 Anatomy of TRAF2. Distinct domains for nuclear factor-kappaB activation and association with tumor necrosis factor signaling proteins.
8681376 1996 Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death.
8621670 1996 Systematic mutational analysis of the death domain of the tumor necrosis factor receptor 1-associated protein TRADD.
8612133 1996 TNF-dependent recruitment of the protein kinase RIP to the TNF receptor-1 signaling complex.
8565075 1996 TRADD-TRAF2 and TRADD-FADD interactions define two distinct TNF receptor 1 signal transduction pathways.
7758105 1995 The TNF receptor 1-associated protein TRADD signals cell death and NF-kappa B activation.
1040062 1975 [Nurses replies to expectations of the nursing profession].