Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (13)

PDB (130)

Gene RIF (4)

AA Sequence

PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKS      1 - 70
DFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLW     71 - 140
SS                                                                        141 - 142
//

Text Mined References (14)

PMID Year Title