Property Summary

NCBI Gene PubMed Count 60
PubMed Score 39.29
PubTator Score 38.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
hepatocellular carcinoma -1.500 1.7e-03
Waldenstrons macroglobulinemia 1.599 9.5e-03
Multiple myeloma 2.249 2.6e-04
malignant mesothelioma 1.500 5.9e-07
psoriasis 1.300 1.1e-04
osteosarcoma -1.430 7.9e-06
group 3 medulloblastoma 2.400 7.0e-04
glioblastoma 1.300 2.8e-03
medulloblastoma, large-cell 1.300 6.7e-06
primitive neuroectodermal tumor 1.200 1.8e-02
acute quadriplegic myopathy 1.138 3.4e-06
lung cancer -1.800 1.3e-04
diabetes mellitus -1.100 2.8e-03
aldosterone-producing adenoma -1.030 2.7e-02
Breast cancer -1.200 2.1e-13
ovarian cancer 2.200 1.7e-05
dermatomyositis 1.500 2.1e-04

Gene RIF (28)

PMID Text
26298634 that TRA2beta promotes glioma cell growth and migration, and could be a candidate for molecular targeting during gene therapy treatments of glioma
26261585 Tra2beta was significantly upregulated in prostate carcinoma, and multivariate analysis confirmed Tra2beta as an independent prognostic factor.
26013829 SRPK1 is a regulator of Tra2beta1 splicing function and individual domains engage in considerable cross-talk, assuming novel functions with regard to RNA binding, splicing, and catalysis.
25970345 Overexpression of either Tra2alpha or Tra2beta results in a marked reduction in HIV-1 Gag/ Env expression.
25970345 HIV-1 Env synthesis is enhanced (slightly) by endogeneous levels of TRA2B; shRNA knockdown of TRA2B reduces Env synthesis slightly (~2 fold) in the HeLa rtTA HIVdletamls cell line (contains stably integrated, doxycycline (Dox) inducible HIV-1 provirus)
25970345 Multiply spliced HIV-1 RNA is increased by TRA2B overexpression resulting in blocking of HIV-1 genomic RNA export
25884434 Results showed that HNRNPG and HTRA2-BETA1 were specific antagonistic regulators of ERa exon7 splicing and increased HNRNPG levels were associated with improved clinical outcome of endometrial cancer through up-regulation of ERaD7 expression.
25416801 HIV-1 Env synthesis is enhanced (slightly) by endogeneous levels of TRA2B; shRNA knockdown of TRA2B reduces Env synthesis slightly (~2 fold) in the HeLa rtTA HIVdletamls cell line (contains stably integrated, doxycycline (Dox) inducible HIV-1 provirus)
25342468 findings suggest that Tra2beta regulates apoptosis by modulating Bcl-2 expression through its competition with miR-204. This novel function may have a crucial role in tumor growth.
25208576 Simultaneous depletion of Tra2alpha and Tra2beta induces substantial shifts in splicing of endogenous Tra2beta target exons, and both constitutive and alternative target exons are under dual Tra2alpha-Tra2beta control.
24952301 Results indicate that transformer 2beta (Tra2beta) was involved in the tumorigenesis of NSCLC and might be a potential therapeutic target of non-small cell lung cancer (NSCLC).
24865968 Facilitating Tra2beta-dependent inclusion of exons in target pre-mRNAs.
24098751 SFRS10 is not expressed in normal human retinae but is upregulated in Age-related macular degeneration retinae.
23748175 Specific induction of hTra2beta1 due to Alternative splicing is associated with epithelial ovarian cancer.
23396973 analysis of mechanisms by which the subcellular and subnuclear localization of Tra2beta proteins are regulated
23361474 Oxidative stress-responsive Transformer 2beta may play an important role in colon cancer growth.
23255807 findings show the inclusion of both HIV-1 exon 3 and vpr mRNA processing is promoted by an exonic splicing enhancer (ESEvpr) localized between exonic splicing silencer ESSV and 5'ss D3; the ESEvpr sequence was found to be bound by members of the Tra2 protein family
23255807 HIV-1 Env synthesis is enhanced (slightly) by endogeneous levels of TRA2B; shRNA knockdown of TRA2B reduces Env synthesis slightly (~2 fold) in the HeLa rtTA HIVdletamls cell line (contains stably integrated, doxycycline (Dox) inducible HIV-1 provirus)
21803291 reduced expression of SFRS10, as observed in tissues from obese humans, alters LPIN1 splicing, induces lipogenesis, and therefore contributes to metabolic phenotypes associated with obesity.
20926394 Results indicates that the Human Transformer2-beta RNA recognition motif recognizes two types of RNA sequences in different RNA binding modes.
20607830 nuclear hnRNP G level as well as hTra2-beta1 level were independent prognostic factors for endometrial cancer progression-free survival
20074680 DARPP-32 changes the usage of tra2-beta1 dependent alternative exons in a concentration-dependent manner, suggesting that the DARPP-32:tra2-beta1 interaction is a molecular link between signaling pathways and pre-mRNA processing.
19037821 hTra2-beta1 expression in cervical cancer. The observed shuttle process of this splicing factor with higher concentrations in the nucleus effects on the cellular function and tumor biology, leading to the worse patient outcome.
14520560 Reduced SMN protein levels cause a reduction in the amount of its interacting proteins and of Htra2-beta1 in both discordant and non-discordant spinal muscular atrophy phenotypes.
12798777 Tra2beta1 transcript levels are developmentally regulated in a tissue- and temporal-specific pattern, although expression is ubiquitous.
12649279 results implicate the human tau gene as a target gene for the alternative splicing regulator Tra2 beta protein, suggesting that Tra2 beta may play a role in aberrant tau exon 10 alternative splicing
12531473 interacts with calcitonin/CGRP exon 4 exonic splice enhancer; required for calcitonin splicing in vitro
6434 HIV-1 Env synthesis is enhanced (slightly) by endogeneous levels of TRA2B; shRNA knockdown of TRA2B reduces Env synthesis slightly (~2 fold) in the HeLa rtTA HIVdletamls cell line (contains stably integrated, doxycycline (Dox) inducible HIV-1 provirus)

AA Sequence

MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTR      1 - 70
SRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSK     71 - 140
YGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR    141 - 210
PTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRS    211 - 280
RSYSPRRY                                                                  281 - 288
//

Text Mined References (69)

PMID Year Title
26298634 2015 Knocking down the expression of TRA2? inhibits the proliferation and migration of human glioma cells.
26261585 2015 Prognostic value of transformer 2? expression in prostate cancer.
26013829 2015 Intra-domain Cross-talk Regulates Serine-arginine Protein Kinase 1-dependent Phosphorylation and Splicing Function of Transformer 2?1.
25970345 2015 Differential Effects of Tra2ß Isoforms on HIV-1 RNA Processing and Expression.
25884434 2015 HNRNP G and HTRA2-BETA1 regulate estrogen receptor alpha expression with potential impact on endometrial cancer.
25342468 2015 Transformer 2? and miR-204 regulate apoptosis through competitive binding to 3' UTR of BCL2 mRNA.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25208576 2014 Human Tra2 proteins jointly control a CHEK1 splicing switch among alternative and constitutive target exons.
24952301 2014 Transformer 2? (Tra2?/SFRS10) positively regulates the progression of NSCLC via promoting cell proliferation.
24865968 2014 HuR regulates alternative splicing of the TRA2? gene in human colon cancer cells under oxidative stress.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24098751 2013 Expression analysis of an evolutionarily conserved alternative splicing factor, Sfrs10, in age-related macular degeneration.
23748175 2013 Alterations in expression pattern of splicing factors in epithelial ovarian cancer and its clinical impact.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23396973 2013 Characterization of nuclear localization signals (NLSs) and function of NLSs and phosphorylation of serine residues in subcellular and subnuclear localization of transformer-2? (Tra2?).
23361474 2013 Ets1 and heat shock factor 1 regulate transcription of the Transformer 2? gene in human colon cancer cells.
23255807 2013 Tra2-mediated recognition of HIV-1 5' splice site D3 as a key factor in the processing of vpr mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21803291 2011 Expression of the splicing factor gene SFRS10 is reduced in human obesity and contributes to enhanced lipogenesis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20926394 2011 Structural basis for the dual RNA-recognition modes of human Tra2-? RRM.
20607830 2011 Expression levels of hnRNP G and hTra2-beta1 correlate with opposite outcomes in endometrial cancer biology.
20074680 DARPP-32 binds to tra2-beta1 and influences alternative splicing.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19282290 2009 Heterogeneous nuclear ribonucleoprotein G regulates splice site selection by binding to CC(A/C)-rich regions in pre-mRNA.
19037821 2009 Significance of nuclear hTra2-beta1 expression in cervical cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15169763 2004 Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization.
15009664 2004 Tau exon 10, whose missplicing causes frontotemporal dementia, is regulated by an intricate interplay of cis elements and trans factors.
14765198 2004 Dephosphorylated SRp38 acts as a splicing repressor in response to heat shock.
14729963 2004 Human RNPS1 and its associated factors: a versatile alternative pre-mRNA splicing regulator in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
14520560 2003 Evidence for a modifying pathway in SMA discordant families: reduced SMN level decreases the amount of its interacting partners and Htra2-beta1.
12798777 2003 Expression of Tra2beta isoforms is developmentally regulated in a tissue- and temporal-specific pattern.
12761049 2003 HnRNP G and Tra2beta: opposite effects on splicing matched by antagonism in RNA binding.
12649279 2003 Mutations in tau gene exon 10 associated with FTDP-17 alter the activity of an exonic splicing enhancer to interact with Tra2 beta.
12604596 2003 Tumor necrosis factor receptor-associated death domain protein is involved in the neurotrophin receptor-mediated antiapoptotic activity of nerve growth factor in breast cancer cells.
12531473 2003 Human transformer 2beta and SRp55 interact with a calcitonin-specific splice enhancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12165565 2002 hnRNP-G promotes exon 7 inclusion of survival motor neuron (SMN) via direct interaction with Htra2-beta1.
11875052 2002 SRp30c-dependent stimulation of survival motor neuron (SMN) exon 7 inclusion is facilitated by a direct interaction with hTra2 beta 1.
11153908 2000 Exclusion of Htra2-beta1, an up-regulator of full-length SMN2 transcript, as a modifying gene for spinal muscular atrophy.
10749975 2000 RBMY, a probable human spermatogenesis factor, and other hnRNP G proteins interact with Tra2beta and affect splicing.
10713112 2000 A human importin-beta family protein, transportin-SR2, interacts with the phosphorylated RS domain of SR proteins.
10339552 1999 The SRm160/300 splicing coactivator is required for exon-enhancer function.
9790768 1998 Human transformer-2-beta gene (SFRS10): complete nucleotide sequence, chromosomal localization, and generation of a tissue-specific isoform.
9546399 1998 Human Tra2 proteins are sequence-specific activators of pre-mRNA splicing.
9473574 1998 Cloning of a gene, YT521, for a novel RNA splicing-related protein induced by hypoxia/reoxygenation.
9212162 1997 Molecular cloning of htra2-beta-1 and htra2-beta-2, two human homologs of tra-2 generated by alternative splicing.
8617505 1996 The I.M.A.G.E. Consortium: an integrated molecular analysis of genomes and their expression.
7499316 1995 Cloning of a novel RNA binding polypeptide (RA301) induced by hypoxia/reoxygenation.