Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.67
PubTator Score 3.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer -1.100 6.2e-03
hepatocellular carcinoma -1.100 1.9e-03
pancreatic cancer -1.500 3.5e-03
interstitial lung disease 1.200 2.1e-02
Multiple myeloma 1.001 6.4e-03
astrocytic glioma 1.700 8.2e-03
ependymoma 1.800 9.3e-03
oligodendroglioma 1.600 7.4e-03
psoriasis -2.800 8.5e-05
osteosarcoma 3.189 2.9e-07
group 3 medulloblastoma 1.400 4.7e-02
diabetes mellitus -1.100 2.8e-03
pancreatic carcinoma -1.500 3.5e-03
acute myeloid leukemia 1.300 3.1e-02
Pick disease 1.200 1.9e-04

Gene RIF (6)

PMID Text
25970345 Overexpression of either Tra2alpha or Tra2beta results in a marked reduction in HIV-1 Gag/ Env expression.
25970345 HIV-1 Env protein expression is inhibited by the overexpression of TRA2A (in 293T cells), both full length isoform and truncated N-terminal isoform
25970345 HIV-1 RNA splice site usage is altered by the overexpression of TRA2A (in 293T cells) and different isoforms of TRA2A exhibit different altered splice site usage patterns
23255807 findings show the inclusion of both HIV-1 exon 3 and vpr mRNA processing is promoted by an exonic splicing enhancer (ESEvpr) localized between exonic splicing silencer ESSV and 5'ss D3; the ESEvpr sequence was found to be bound by members of the Tra2 protein family
23255807 HIV-1 Env protein expression is inhibited by the overexpression of TRA2A (in 293T cells), both full length isoform and truncated N-terminal isoform
21447598 Expression of tumor-promoting Cyr61 is regulated by hTRA2-beta1 and acidosis.

AA Sequence

MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYTR      1 - 70
SRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFS     71 - 140
RYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMG    141 - 210
RPTHSGGGGGGGGGGGGGGGGRRRDSYYDRGYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPR    211 - 280
RY                                                                        281 - 282
//

Text Mined References (27)

PMID Year Title
25970345 2015 Differential Effects of Tra2ß Isoforms on HIV-1 RNA Processing and Expression.
23255807 2013 Tra2-mediated recognition of HIV-1 5' splice site D3 as a key factor in the processing of vpr mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21447598 2011 Expression of tumor-promoting Cyr61 is regulated by hTRA2-?1 and acidosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14765198 2004 Dephosphorylated SRp38 acts as a splicing repressor in response to heat shock.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
9546399 1998 Human Tra2 proteins are sequence-specific activators of pre-mRNA splicing.
8799144 1996 A human homologue of the Drosophila sex determination factor transformer-2 has conserved splicing regulatory functions.