Property Summary

NCBI Gene PubMed Count 76
PubMed Score 165.65
PubTator Score 104.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma 1.300 5.4e-07
psoriasis 1.600 4.0e-11
glioblastoma 3.200 6.6e-06
posterior fossa group A ependymoma 2.000 5.6e-07
sonic hedgehog group medulloblastoma 3.500 2.1e-10
atypical teratoid / rhabdoid tumor 3.200 1.3e-13
medulloblastoma, large-cell 3.800 2.1e-08
primitive neuroectodermal tumor 3.100 1.1e-06
Atopic dermatitis 1.400 2.3e-03
adrenocortical carcinoma 3.021 4.9e-08
non-small cell lung cancer 4.036 2.4e-40
intraductal papillary-mucinous carcinoma... 2.000 3.7e-04
intraductal papillary-mucinous neoplasm ... 2.500 1.4e-03
colon cancer 1.900 3.7e-03
lung cancer 4.900 1.7e-05
pancreatic cancer 1.700 4.2e-07
breast carcinoma 1.900 7.7e-49
Breast cancer 4.100 2.2e-02
interstitial cystitis 1.600 6.0e-03
lung adenocarcinoma 1.900 2.0e-11
pediatric high grade glioma 3.000 1.6e-07
nasopharyngeal carcinoma 1.100 1.1e-04
Endometriosis 1.711 1.5e-02
ductal carcinoma in situ 2.200 1.2e-03
invasive ductal carcinoma 3.400 1.2e-04
ovarian cancer 2.700 3.7e-08

Gene RIF (53)

PMID Text
27053618 MiR-491 inhibits hepatocellular carcinoma cell proliferation, invasion and migration by downregulating the expression of TPX2.
26624896 expression of both TPX2 and PD-L1 are associated with persistence/recurrence of cervical intraepithelial neoplasia after cervical conization
26414402 Data show that cytoskeleton associated protein 5 (chTOG) only weakly promotes importin-regulated microtubule nucleation, but acts synergistically with TPX2 protein.
26279431 TPX2 was a target gene of miR-491.
26257190 the levels and distribution of TPX2 are likely to be determinants of when and where kinesin-5 acts in neurons.
26240182 Aurora A-dependent TPX2 phosphorylation controls mitotic spindle length through regulating microtubule flux.
26018074 Dimeric, but not monomeric, Eg5 was differentially inhibited by full-length and truncated TPX2, demonstrating that dimerization or residues in the neck region are important for the interaction of TPX2 with Eg5.
25914189 These results indicated that TPX2 has an impact on tumor angiogenesis in pancreatic cancer.
25830658 a causative link between altered function of AURKA-HMMR-TPX2-TUBG1 and breast carcinogenesis in BRCA1/2 mutation carriers
25632068 Propose TPX2 and AURKA as novel co-regulators on the MYC pathway in colorectal neoplasms.
25365214 our study is the first indication of a constitutive control of TPX2 on H4K16ac levels, with potential implications for DNA damage response.
25302620 In vitro studies found that TPX2 knockdown significantly inhibited cell proliferation and viability in both Hep3B and HepG2 cells.
25239289 TPX2 siRNA transfection significantly reduced tumor growth.
24875404 Identify RHAMM as a critical regulator of TPX2 location/ Aurora kinase A signaling and suggest that RHAMM ensures bipolar spindle assembly and mitotic progression through the integration of biochemical and structural pathways.
24867643 the molecular mechanisms of two distinct activation strategies (autophosphorylation and TPX2-mediated activation) in human Aurora A kinase, was elucidated.
24718984 The results demonstrated that TPX2 is important in the regulation of tumor growth in cervical cancer and therefore may be a potential therapeutic target as a novel treatment strategy.
24625450 RAN nucleo-cytoplasmic transport and mitotic spindle assembly partners XPO7 and TPX2 have roles in serous epithelial ovarian cancer
24556998 This review provides an historic overview of the discovery of TPX2 and summarizes its cytoskeletal and signaling roles with relevance to cancer therapies. [review]
24488334 TPX2 overexpression is associated with medullary thyroid carcinoma.
24341487 TPX2 plays an important role in promoting tumorigenesis and metastasis of human colon cancer, and may represent a novel prognostic biomarker and therapeutic target for the disease
23963785 TPX2 expression is associated with cell proliferation and poor prognosis among patients with resected esophageal squamous cell carcinoma
23873098 Data indicate that TPX2 (target protein for Xklp2) may play a role in the development and progression of bladder carcinoma, and suggest that inhibition of TPX2 level may be a novel strategy for therapy of the patients with bladder carcinoma.
23725757 The expression of TPX2 protein and mRNA were correlated with invasive depth and lymphatic metastasis of esophageal squamous cell carcinoma.
23444224 Data show that five genes CKAP5, KPNB1, RAN, TPX2 and KIF11 were shown to be essential for tumor cell survival in both head and neck squamous cell carcinoma (HNSCC)and non-small cell lung cancer (NSCLC), but most particularly in HNSCC.
23357462 Data indicate that expression-based risk indices of three genes UBE2C, TPX2, and MELK were more strongly associated with poor 5-year survival in adenocarcinoma patients.
23333597 GLIPR1 interacts with Hsc70, and GLIPR1 overexpression or Hsc70 knockdown leads to transcriptional suppression of AURKA and TPX2.
23328114 Data indicate that the sensitivity of cell-lines with amplification of AURKA depends upon the activity of the kinase, which correlates with the expression of the regulatory gene products TPX2 and HMMR/RHAMM.
23045526 the regulation of gamma-H2AX signals by TPX2 is not associated with apoptosis or the mitotic functions of TPX2.
22761906 AIM1, ERGIC1, and TPX2 were shown to be highly expressed especially in prostate cancer tissues, and high mRNA expression of ERGIC1 and TMED3 associated with AR and ERG oncogene expression
22560880 The data support the role of TPX2 as a novel co-activator of Aurora kinase B.
22307108 TPX2 shows potential to be used as a new marker for cervical cancer diagnosis and therapy.
22207630 TPX2 promote 20q amplicon-driven progression of colorectal adenoma to carcinoma.
21347367 two switches determining Aurora A activation
21187329 Results demonstrate a role for PP6 as the T-loop phosphatase regulating Aurora A activity bound to its activator TPX2 during mitotic spindle formation.
21147853 TPX2 protects Aurora-A from degradation both in interphase and in mitosis.
21099343 Decreased AurA-TPX2 complex formation in response to irradiation results from reduced cellular levels of TPX2, as a result of protein degradation and decreased translation of TPX2 mRNA.
20708655 association of Aurora-A and TPX2 gives rise to a novel functional unit with oncogenic properties.[review]
20599806 TPX2 expression is associated with the progression of malignant astrocytoma.
20508983 Observational study of gene-disease association. (HuGE Navigator)
19801554 Data show that Aurora A(S155R) mutant reduced cellular activity and mislocalization are due to loss of interaction with TPX2.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19424574 Overexpression of TPX2 is associated with oral squamous cell carcinomas.
19208764 Data provide a molecular explanation for the assembly of the apoptotic microtubule network, and suggest important similarities with the process of RanGTP- and TPX2-mediated mitotic spindle formation.
19148505 human TPX2 mRNA is closely linked to increased or abnormal cell proliferation in malignant salivary gland tumors.
18663142 Chromosome nucleation is involved in spindle pole separation and setting spindle length. A second Aurora A-independent function of TPX2 is required to bipolarize spindles.
17716627 Data show that Siah2 is an important mediator of repp86 protein degradation.
17705509 TPX2 binding decreases the size and accessibility of a hydrophobic pocket, adjacent to the ATP site, to inhibitors.
16489064 Aberrant expression of TPX2 may play important role(s) in both malignant transformation of respiratory epithelium and progression of squamous cell lung cancer and could serve as a prognostic predictor for the disease.
16287863 APC/C(Cdh1) controls the stability of TPX2, thereby ensuring accurate regulation of the spindle assembly in the cell cycle
12612055 molecular cloning; overexpression provokes accumulation of cells in G(2)-M phase and subsequent polyploidization, suggesting that excess repp86 may interfere with correct nuclear division
12477396 observations reveal a structural role for hTPX2 in spindles and provide evidence for a balance between microtubule-based motor forces and structural spindle components
12389033 spindle formation requires the function of TPX2 to generate a stable bipolar spindle with overlapping antiparallel microtubule arrays
12177045 TPX2 is required for targeting Aurora-A kinase to the spindle apparatus and Aurora-A might regulate the function of TPX2 during spindle assembly

AA Sequence

MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAI      1 - 70
VTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRRSLRLSAQKDLEQKEKHHVKM     71 - 140
KAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTAEKNASSPEKAKGRHTVPCMPPAKQKFLKST    141 - 210
EEQELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKE    211 - 280
VNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDD    281 - 350
INLLPSKSSVTKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK    351 - 420
KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLPITVPKSPAFA    421 - 490
LKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSFDSRDKERQLQKEKKIKELQK    491 - 560
GEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRRGALKAQTWKHQLEEELRQQKEAACFKARPN    561 - 630
TVISQEPFVPKKEKKSVAEGLSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK    631 - 700
KEELARLRRELVHKANPIRKYQGLEIKSSDQPLTVPVSPKFSTRFHC                           701 - 747
//

Text Mined References (88)

PMID Year Title
27053618 2016 [miR-491 inhibits the proliferation, invasion and migration of hepatocellular carcinoma cell via down-regulating TPX2 expression].
26624896 2015 Positive Surgical Margin, HPV Persistence, and Expression of Both TPX2 and PD-L1 Are Associated with Persistence/Recurrence of Cervical Intraepithelial Neoplasia after Cervical Conization.
26414402 2015 Complementary activities of TPX2 and chTOG constitute an efficient importin-regulated microtubule nucleation module.
26279431 2015 Low Expression of miR-491 Promotes Esophageal Cancer Cell Invasion by Targeting TPX2.
26257190 2015 TPX2 regulates neuronal morphology through kinesin-5 interaction.
26240182 2015 TPX2 phosphorylation maintains metaphase spindle length by regulating microtubule flux.
26165940 2015 GM130 Regulates Golgi-Derived Spindle Assembly by Activating TPX2 and Capturing Microtubules.
26018074 2015 TPX2 Inhibits Eg5 by Interactions with Both Motor and Microtubule.
25914189 2015 Therapeutic potential of targeting protein for Xklp2 silencing for pancreatic cancer.
25830658 2015 Assessing associations between the AURKA-HMMR-TPX2-TUBG1 functional module and breast cancer risk in BRCA1/2 mutation carriers.
25632068 2015 The AURKA/TPX2 axis drives colon tumorigenesis cooperatively with MYC.
25365214 2014 TPX2 impacts acetylation of histone H4 at lysine 16: implications for DNA damage response.
25302620 2014 TPX2 is a prognostic marker and contributes to growth and metastasis of human hepatocellular carcinoma.
25239289 2014 TPX2 siRNA regulates growth and invasion of esophageal cancer cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24875404 2014 Spatial regulation of Aurora A activity during mitotic spindle assembly requires RHAMM to correctly localize TPX2.
24867643 2014 Molecular mechanism of Aurora A kinase autophosphorylation and its allosteric activation by TPX2.
24718984 2014 TPX2 regulates tumor growth in human cervical carcinoma cells.
24625450 2014 RAN nucleo-cytoplasmic transport and mitotic spindle assembly partners XPO7 and TPX2 are new prognostic biomarkers in serous epithelial ovarian cancer.
24556998 2014 TPX2: of spindle assembly, DNA damage response, and cancer.
24488334 2014 TPX2 overexpression in medullary thyroid carcinoma mediates TT cell proliferation.
24341487 2013 TPX2 is a novel prognostic marker for the growth and metastasis of colon cancer.
23963785 2014 TPX2 expression is associated with cell proliferation and patient outcome in esophageal squamous cell carcinoma.
23873098 2013 Target protein for Xklp2 (TPX2), a microtubule-related protein, contributes to malignant phenotype in bladder carcinoma.
23725757 2013 Upregulation of the TPX2 gene is associated with enhanced tumor malignance of esophageal squamous cell carcinoma.
23444224 2013 Functional genetic screens identify genes essential for tumor cell survival in head and neck and lung cancer.
23357462 2013 Network-based approach identified cell cycle genes as predictor of overall survival in lung adenocarcinoma patients.
23333597 2013 Glioma pathogenesis-related protein 1 induces prostate cancer cell death through Hsc70-mediated suppression of AURKA and TPX2.
23328114 2013 Genomic imbalance of HMMR/RHAMM regulates the sensitivity and response of malignant peripheral nerve sheath tumour cells to aurora kinase inhibition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045526 2012 Targeting protein for xenopus kinesin-like protein 2 (TPX2) regulates ?-histone 2AX (?-H2AX) levels upon ionizing radiation.
22761906 2012 High-throughput transcriptomic and RNAi analysis identifies AIM1, ERGIC1, TMED3 and TPX2 as potential drug targets in prostate cancer.
22560880 2012 A novel role for TPX2 as a scaffold and co-activator protein of the Chromosomal Passenger Complex.
22307108 2012 The TPX2 gene is a promising diagnostic and therapeutic target for cervical cancer.
22207630 2012 TPX2 and AURKA promote 20q amplicon-driven colorectal adenoma to carcinoma progression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21347367 2011 Two TPX2-dependent switches control the activity of Aurora A.
21187329 2010 Protein phosphatase 6 regulates mitotic spindle formation by controlling the T-loop phosphorylation state of Aurora A bound to its activator TPX2.
21147853 2011 Control of Aurora-A stability through interaction with TPX2.
21099343 2010 Mitotic DNA damage targets the Aurora A/TPX2 complex.
20708655 2010 The Aurora-A/TPX2 complex: a novel oncogenic holoenzyme?
20599806 2010 Expression of targeting protein for Xenopus kinesin-like protein 2 is associated with progression of human malignant astrocytoma.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19801554 2009 A cancer-associated aurora A mutant is mislocalized and misregulated due to loss of interaction with TPX2.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19424574 2009 Overexpression of the receptor for hyaluronan-mediated motility, correlates with expression of microtubule-associated protein in human oral squamous cell carcinomas.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19208764 2009 Dynamic release of nuclear RanGTP triggers TPX2-dependent microtubule assembly during the apoptotic execution phase.
19148505 2009 Expression of TPX2 in salivary gland carcinomas.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18663142 2008 Building a spindle of the correct length in human cells requires the interaction between TPX2 and Aurora A.
18662907 2008 Modulation of kinase-inhibitor interactions by auxiliary protein binding: crystallography studies on Aurora A interactions with VX-680 and with TPX2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17716627 2007 Regulation of repp86 stability by human Siah2.
17705509 2007 Binding of TPX2 to Aurora A alters substrate and inhibitor interactions.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16489064 2006 Expression of targeting protein for xklp2 associated with both malignant transformation of respiratory epithelium and progression of squamous cell lung cancer.
16341674 2005 Transcriptome analysis of human gastric cancer.
16287863 2005 Anaphase-promoting complex/cyclosome controls the stability of TPX2 during mitotic exit.
15705883 2005 Receptor for hyaluronan-mediated motility correlates with centrosome abnormalities in multiple myeloma and maintains mitotic integrity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14718566 2004 TOGp, the human homolog of XMAP215/Dis1, is required for centrosome integrity, spindle pole organization, and bipolar spindle assembly.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14580337 2003 Structural basis of Aurora-A activation by TPX2 at the mitotic spindle.
12612055 2003 repp86: A human protein associated in the progression of mitosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477396 2002 hTPX2 is required for normal spindle morphology and centrosome integrity during vertebrate cell division.
12389033 2002 Chromosome-induced microtubule assembly mediated by TPX2 is required for spindle formation in HeLa cells.
12177045 2002 Human TPX2 is required for targeting Aurora-A kinase to the spindle.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
10871281 2000 TPX2, A novel xenopus MAP involved in spindle pole organization.
10512675 1999 Identification of genes (SPON2 and C20orf2) differentially expressed between cancerous and noncancerous lung cells by mRNA differential display.
10393424 1999 Assignment of human proliferation associated p100 gene (C20orf1) to human chromosome band 20q11.2 by in situ hybridization.
9207457 1997 p100: a novel proliferation-associated nuclear protein specifically restricted to cell cycle phases S, G2, and M.