Property Summary

NCBI Gene PubMed Count 2
PubMed Score 16.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 3 medulloblastoma 2254 2.0e-04
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0

 GWAS Trait (1)

AA Sequence

MPAAFPCVFPPQSLQVFPQMIVKVWEKQSLPLPGLRGSPVERLYLPRNELDNPHKQKAWKIYPPEFAVEI      1 - 70
LFGMVSVDSLLFVLSSPHWWLHLAQGSFWMSEGGFSLCHPGWSVVAQSLLTSTSAFCVRAILLPQPPE       71 - 138
//

Text Mined References (3)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.