Property Summary

NCBI Gene PubMed Count 89
PubMed Score 549.96
PubTator Score 400.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -4.000 3.4e-02
ovarian cancer -1.800 9.6e-06

Gene RIF (64)

PMID Text
26425551 These data may suggest an involvement of translationally controlled tumor protein in normal physiology and carcinogenesis.
26328748 Downregulation of the expression of TCTP inhibits the migration and invasion of glioma cells.
25936523 Results demonstrate that TCTP mRNA translation is regulated by signalling through the PI3-K/Akt/mTORC1 pathway in neoplasms.
25779659 High phospho-TCTP expression levels are associated with aggressive breast cancer.
25423047 analysis of how TCTP-PTD penetrates A549 human lung cancer cell membranes and promotes protein internalization
25396429 TCTP binds to hemin and functions as a "buffer protein", controlling cellular homeostasis.
25363345 High HRF expression is associated with non-Hodgkin lymphomas.
25277244 Targeting Hsp27 interaction with TCTP, a partner protein identified in a genetic screen, increases therapy sensitivity, and could decrease or abolish toxicity to normal cells.
25270224 Data indicate that Tanshinone IIA (Tan-IIA)T upregulated the protein expression of CHOP and Bax, but downregulated the protein expression of BiP, TCTP, Mcl-1 and Bcl-xL.
25263704 osteoclastogenic activity of translationally-controlled tumor protein (TCTP) with reciprocal repression of p21
25092287 TCTP is functionally implicated in the progression of NF1-associated tumors.
24657995 TCTP is a novel mediator of endothelial prosurvival and growth in patients with pulmonary arterial hypertension.
24606760 Interaction of translationally controlled tumor protein with Apaf-1 is involved in the development of chemoresistance in HeLa cells.
24465583 Plasmodium falciparum TCTP showed a lower B cell proliferative effect than human TCTP.
24311645 High TCTP expression is associated with glioma.
24165482 observations indicate that TCTP enhances Pim-3 stability to simultaneously promote and prevent cell-cycle progression and apoptosis, respectively
24106833 Cofilin-1 expression positively correlates with the tumor grade, and p23 expression correlates with the endoplasmic reticulum positive status.
23894469 TCTP may have a role in prostate cancer development
23749504 Data indicate that translationally controlled tumor protein (TCTP) expression in glioma was an independent prognostic factor, which might be a potential diagnostic and therapeutic target of glioma.
23387829 TCTP binds to the beta domain of VHL through competition with HIF1alpha, which promotes VHL degradation by the ubiquitin-proteasome system and HIF1alpha stability.
23042265 The organization of actin and cytokeratin cytoskeleton and the expression of TCTP, p53,cyclin A, RhoA and actin in HIO180 non-transformed ovarian epithelial cells, and OVCAR3 and SKOV3 ovarian epithelial cancer cells, was studied.
22902387 human miR-27b regulates the expression of the TCTP tumor protein, and circulating miR-27b may be useful as a biomarker for oral cancer research.
22853445 Demonstrate the presence of TCTP in human cornea, and suggest a potential role in the pathogenesis of herpes virus keratitis.
22451927 Data suggest that TCTP may play a critical role in maintaining genomic integrity in response to DNA-damaging agents.
22340241 Results imply that TCTP might be a mediator of PRL-3-promoted proliferation, migration and invasion of human colon cancer cells.
22157679 P53 binds to a P53 responsive element that is present in the promoter of TCTP, leading to the transcriptional repression of TCTP
21953552 CHD1L/TCTP/Cdc25C/Cdk1 molecular pathway causes the malignant transformation of hepatocytes with the phenotypes of accelerated mitotic progression and the production of aneuploidy
21801721 The TCTP is a survival factor that protects cancer cells from oxidative stress-induced cell-death.
21795694 fortilin is a novel p53-interacting molecule and p53 inhibitor
21081126 Results clearly indicate that the interaction between TCTP and p53 prevents apoptosis by destabilizing p53.
20966960 These results identify TCTP-bearing nanovesicles as a novel component of the paracrine apoptotic program of potential importance in vascular repair.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19815065 Data suggest a kind of feedback regulation between TCTP and VDR to regulate a variety of (Ca(2+) dependent) cellular effects and in this way further underscore the physiological relevance of the observed physical interaction beteen TCTP and VDR.
19621893 Knockdown of TCTP inhibited proliferation, migration, and invasion activities of LoVo cells in vitro and in vivo.
19605695 In contrast to the very modest phenotype observed in the thymus, a significant reduction of mature T cells is observed in the peripheral lymphoid organs of two conditional null TCTP mutant mice.
19570981 TCTP interacts with hRheb and accelerates its GDP release in vitro.
19523440 These findings suggest that TCTP may belong to a novel small molecular weight heat shock protein.
19484128 Proton pump inhibitors exert anti-allergic effects by reducing TCTP secretion
19360337 A potential therapeutic application for prostate cancer by targeting TCTP gene using an siRNA approach.
19271148 Data describe the ultrastructure of the choroid plexus, the number of mast cells that may infiltrate it, and the immunodistribution of histamine receptors H4 and histamine-releasing factor.
18976975 Knockdown of tumor protein, translationally-controlled 1 (TPT1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18676370 neither TCTP nor FKBP38 regulates mTORC1 signaling.
18504434 The Chfr-TCTP interaction was stable throughout the cell cycle, but it could be diminished by the complete depolymerization of the microtubules.
18345488 Data show that histamine-releasing factor is found in pannus from rheumatoid arthritis patients, and suggest that it plays a role in the pathogenesis of RA.
18325344 interaction between fortilin and TSC-22 prevents apoptosis via the destabilization of TSC-22 in ovarian carcinoma cells
18274553 study found a structural similarity between the H2-H3 helices of TCTP and the H5-H6 helices of Bax; TCTP antagonizes apoptosis by inserting into the mitochondrial membrane and inhibiting Bax dimerization
18042794 Priming of basophils for histamine release induced by TCTP differs from that induced by interleukin-3.
17897616 analysis of of the weak calcium-binding site of human translationally controlled tumor protein by NMR
17645945 Cross-inhibition assays showed that the patients' IgEs recognize common epitopes on both the human and C. herbarum proteins.
17549383 PAI-1 downregulates TCTP in LnCAP prostatic cancer.
16859841 TPT1 is regulated by CREB transcription factors.
15958728 the expression of TPT1 in the human placenta and a direct role of the protein in placental calcium transport
15319436 role for TSAP6 in the export of TCTP and indicate that this multipass membrane protein could have a general role in the regulation of vesicular trafficking and secretion.
15262975 the fortilin-MCL1 interaction increases cellular resistance to apoptosis by allowing MCL1, an independently antiapoptotic protein, to stabilize another independently antiapoptotic protein, fortilin
15062873 Interaction between HrHRF and EF-1delta taken with some of the recently published information concerning the TCTP (HrHRF) mentioned above suggest a possible intracellular role for TCTP/HrHRF.
14623968 TCTP preferentially stabilized the GDP form of eEF1A, and, furthermore, impaired the GDP exchange reaction promoted by eEF1Bbeta.
14500674 Human recombinant histamine-releasing factor can partially inhibit the secretion of IL-2 and IL-13 protein in a dose-dependent manner from both purified peripheral blood T cells and Jurkat T cells.
12948934 HRF p23 can stimulate nonimmune epithelium such as bronchial epithelium
12876410 Patients with Multiple drug allergy syndrome and more than 1/3 with hypersensitivity to a single antibacterial drug showed the presence of circulating histamine-releasing factors. Such factors might play a role in drug-induced adverse reactions.
12487227 results do not support the hypothesis that IgE(mn+) induces a late allergic reaction (LAR), but do not exclude the alternative hypothesis that HRFs are released during a LAR and contribute to asthma severity
12399545 genetic regulation in tumor reversion
12167714 Human TCTP was identified as a putative Plk-interacting clone by a two-hybrid screen. Plk phosphorylates TCTP on two serine residues in vitro and cofractionates with the majority of kinase activity toward TCTP in mitotic cell lysates.
12149273 Physical and functional interaction between myeloid cell leukemia 1 protein (MCL1) and this protein
11991642 The mRNA of the translationally controlled tumor protein P23/TCTP is a highly structured RNA, which activates the dsRNA-dependent protein kinase PKR (TCTP PROTEIN)

AA Sequence

MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV      1 - 70
DIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENM     71 - 140
NPDGMVALLDYREDGVTPYMIFFKDGLEMEKC                                          141 - 172
//

Text Mined References (95)

PMID Year Title
26425551 2015 Expression of Translationally Controlled Tumor Protein in Human Kidney and in Renal Cell Carcinoma.
26328748 2015 RNA interference?mediated knockdown of translationally controlled tumor protein induces apoptosis, and inhibits growth and invasion in glioma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25936523 2015 Growth-factor dependent expression of the translationally controlled tumour protein TCTP is regulated through the PI3-K/Akt/mTORC1 signalling pathway.
25779659 2015 Phospho-TCTP as a therapeutic target of Dihydroartemisinin for aggressive breast cancer cells.
25423047 2015 Cellular uptake mechanism of TCTP-PTD in human lung carcinoma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25396429 2014 Ligand binding reveals a role for heme in translationally-controlled tumor protein dimerization.
25363345 2015 Histamine-releasing factor/translationally controlled tumor protein plays a role in induced cell adhesion, apoptosis resistance and chemoresistance in non-Hodgkin lymphomas.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
25270224 2014 Tanshinone IIA inhibits human gastric carcinoma AGS cell growth by decreasing BiP, TCTP, Mcl?1 and Bcl?xL and increasing Bax and CHOP protein expression.
25263704 2014 Osteoclastogenic activity of translationally-controlled tumor protein (TCTP) with reciprocal repression of p21.
25092287 2014 Translationally controlled tumor protein is a novel biological target for neurofibromatosis type 1-associated tumors.
24657995 2014 Proteomic analysis implicates translationally controlled tumor protein as a novel mediator of occlusive vascular remodeling in pulmonary arterial hypertension.
24606760 2014 Interaction of translationally controlled tumor protein with Apaf-1 is involved in the development of chemoresistance in HeLa cells.
24465583 2014 The Plasmodium falciparum translationally controlled tumor protein (TCTP) is incorporated more efficiently into B cells than its human homologue.
24311645 2014 TCTP promotes glioma cell proliferation in vitro and in vivo via enhanced ?-catenin/TCF-4 transcription.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24165482 2013 A novel regulatory mechanism of Pim-3 kinase stability and its involvement in pancreatic cancer progression.
24106833 2013 Identification of stage-specific breast markers using quantitative proteomics.
23894469 2013 TCTP is an androgen-regulated gene implicated in prostate cancer.
23749504 2013 TCTP overexpression is associated with the development and progression of glioma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23387829 2013 TCTP increases stability of hypoxia-inducible factor 1? by interaction with and degradation of the tumour suppressor VHL.
23042265 2012 Inverse relationship between TCTP/RhoA and p53 /cyclin A/actin expression in ovarian cancer cells.
22902387 2012 miR-27b-regulated TCTP as a novel plasma biomarker for oral cancer: from quantitative proteomics to post-transcriptional study.
22853445 2012 Translationally controlled tumour protein (TCTP) is present in human cornea and increases in herpetic keratitis.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22451927 2012 Role of the translationally controlled tumor protein in DNA damage sensing and repair.
22340241 2011 Proteomic analysis identifies translationally controlled tumor protein as a mediator of phosphatase of regenerating liver-3-promoted proliferation, migration and invasion in human colon cancer cells.
22157679 2011 Reciprocal repression between P53 and TCTP.
21953552 2012 Translationally controlled tumor protein induces mitotic defects and chromosome missegregation in hepatocellular carcinoma development.
21801721 2011 TCTP is a critical survival factor that protects cancer cells from oxidative stress-induced cell-death.
21795694 2011 Physical and functional antagonism between tumor suppressor protein p53 and fortilin, an anti-apoptotic protein.
21278788 2011 Translationally controlled tumor protein induces human breast epithelial cell transformation through the activation of Src.
21269460 2011 Initial characterization of the human central proteome.
21081126 2011 Anti-apoptotic protein TCTP controls the stability of the tumor suppressor p53.
20966960 2011 Caspase-3-dependent export of TCTP: a novel pathway for antiapoptotic intercellular communication.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19815065 2010 H2O2-dependent translocation of TCTP into the nucleus enables its interaction with VDR in human keratinocytes: TCTP as a further module in calcitriol signalling.
19621893 2010 The role of translationally controlled tumor protein in tumor growth and metastasis of colon adenocarcinoma cells.
19605695 2009 Critical roles of translationally controlled tumor protein in the homeostasis and TCR-mediated proliferation of peripheral T cells.
19570981 2009 Molecular basis of the acceleration of the GDP-GTP exchange of human ras homolog enriched in brain by human translationally controlled tumor protein.
19523440 2009 Translationally controlled tumor protein is a novel heat shock protein with chaperone-like activity.
19484128 2009 Proton pump inhibitors exert anti-allergic effects by reducing TCTP secretion.
19360337 2009 Gene silencing of translationally controlled tumor protein (TCTP) by siRNA inhibits cell growth and induces apoptosis of human prostate cancer cells.
19271148 2009 Morphology and immuno-distribution of the histamine H4 receptor and histamine--releasing factor in choroid plexus of patients with paraneoplastic cerebellar degeneration.
18676370 2008 Re-evaluating the roles of proposed modulators of mammalian target of rapamycin complex 1 (mTORC1) signaling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18504434 2008 Chfr interacts and colocalizes with TCTP to the mitotic spindle.
18345488 2008 Histamine releasing factor (HRF) in pannus of joints affected by rheumatoid arthritis.
18325344 2008 Interaction between fortilin and transforming growth factor-beta stimulated clone-22 (TSC-22) prevents apoptosis via the destabilization of TSC-22.
18274553 2008 TCTP protects from apoptotic cell death by antagonizing bax function.
18042794 2008 Distinct characteristics of signal transduction events by histamine-releasing factor/translationally controlled tumor protein (HRF/TCTP)-induced priming and activation of human basophils.
17897616 2007 Solution structure and mapping of a very weak calcium-binding site of human translationally controlled tumor protein by NMR.
17645945 2008 Cladosporium herbarum translationally controlled tumor protein (TCTP) is an IgE-binding antigen and is associated with disease severity.
17549383 2007 PAI-1 induces cell detachment, downregulates nucleophosmin (B23) and fortilin (TCTP) in LnCAP prostate cancer cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16859841 2006 Expression of the human TPT1 gene coding for translationally controlled tumor protein (TCTP) is regulated by CREB transcription factors.
16730713 2006 Inhibition of Na,K-ATPase-suppressive activity of translationally controlled tumor protein by sorting nexin 6.
16548883 2006 Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.
16193335 2006 Serological identification and bioinformatics analysis of immunogenic antigens in multiple myeloma.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15958728 2005 The translationally controlled tumor protein is a novel calcium binding protein of the human placenta and regulates calcium handling in trophoblast cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383549 2004 Translationally controlled tumor protein interacts with the third cytoplasmic domain of Na,K-ATPase alpha subunit and inhibits the pump activity in HeLa cells.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15319436 2004 TSAP6 facilitates the secretion of translationally controlled tumor protein/histamine-releasing factor via a nonclassical pathway.
15262975 2004 Antiapoptotic protein partners fortilin and MCL1 independently protect cells from 5-fluorouracil-induced cytotoxicity.
15162379 2004 Translationally controlled tumor protein (TCTP) in the human prostate and prostate cancer cells: expression, distribution, and calcium binding activity.
15062873 2004 Identification of the interaction between the human recombinant histamine releasing factor/translationally controlled tumor protein and elongation factor-1 delta (also known as eElongation factor-1B beta).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623968 2003 Translationally controlled tumor protein acts as a guanine nucleotide dissociation inhibitor on the translation elongation factor eEF1A.
14500674 2003 Inhibition of cytokine gene transcription by the human recombinant histamine-releasing factor in human T lymphocytes.
12948934 2004 Stimulation of human bronchial epithelial cells by IgE-dependent histamine-releasing factor.
12876410 2003 Sera from patients with multiple drug allergy syndrome contain circulating histamine-releasing factors.
12487227 2002 Lack of correlation between bronchial late allergic reaction to Dermatophagoides pteronyssinus and in vitro immunoglobulin E reactivity to histamine-releasing factor derived from mononuclear cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399545 2002 Biological models and genes of tumor reversion: cellular reprogramming through tpt1/TCTP and SIAH-1.
12167714 2002 Plk phosphorylation regulates the microtubule-stabilizing protein TCTP.
12149273 2002 Physical and functional interaction between myeloid cell leukemia 1 protein (MCL1) and Fortilin. The potential role of MCL1 as a fortilin chaperone.
11991642 2002 The mRNA of the translationally controlled tumor protein P23/TCTP is a highly structured RNA, which activates the dsRNA-dependent protein kinase PKR.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11598139 2001 Characterization of fortilin, a novel antiapoptotic protein.
11368327 2000 Identification of the self-interaction of rat TCTP/IgE-dependent histamine-releasing factor using yeast two-hybrid system.
10343127 1999 Chromosomal localization of tumor protein, translationally-controlled 1 (TPT1) encoding the human histamine releasing factor (HRF) to 13q12-->q14.
9150946 Two-dimensional electrophoretic analysis of human breast carcinoma proteins: mapping of proteins that bind to the SH3 domain of mixed lineage kinase MLK2.
9059837 1997 Translationally controlled tumor protein: a protein identified in several nontumoral cells including erythrocytes.
7821789 1994 Construction of a human full-length cDNA bank.
7542803 1995 Molecular identification of an IgE-dependent histamine-releasing factor.
2813067 1989 cDNA sequence coding for a translationally controlled human tumor protein.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.