Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.13
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.8e-05

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 1.8e-05

Gene RIF (1)

AA Sequence

MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSL      1 - 70
IHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNI     71 - 140
SSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQ    141 - 210
IVRDDMLCAGSENHDSCQGDSGGPLVCKVNGT                                          211 - 242
//

Text Mined References (13)

PMID Year Title