Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.88
PubTator Score 2.03

Knowledge Summary


No data available


  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.100 6.8e-18
breast carcinoma 1.400 2.5e-03
glioblastoma 1.100 9.6e-05
group 3 medulloblastoma 1.900 1.7e-04
hereditary spastic paraplegia -1.426 4.1e-03
limb girdle muscular dystrophy 2A -1.020 1.1e-03
lung cancer 1.300 9.1e-04
medulloblastoma, large-cell 1.100 1.5e-03
Multiple myeloma 1.362 2.6e-03
oligodendroglioma 1.200 4.3e-14
ovarian cancer 1.100 2.9e-02
primitive neuroectodermal tumor 1.400 5.8e-04
Waldenstrons macroglobulinemia 1.003 4.4e-02

AA Sequence

NITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL                                       141 - 175

Text Mined References (18)

PMID Year Title