Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.21
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.003 4.4e-02
Multiple myeloma 1.362 2.6e-03
astrocytoma 1.100 6.8e-18
glioblastoma 1.300 9.9e-03
oligodendroglioma 1.200 4.3e-14
group 3 medulloblastoma 1.900 1.7e-04
medulloblastoma, large-cell 1.100 1.5e-03
primitive neuroectodermal tumor 1.400 5.8e-04
hereditary spastic paraplegia -1.426 4.1e-03
limb girdle muscular dystrophy 2A -1.020 1.1e-03
lung cancer 1.600 1.3e-04
breast carcinoma 1.400 2.5e-03
ovarian cancer 1.100 2.9e-02

AA Sequence

MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKM      1 - 70
KTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIM     71 - 140
NITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL                                       141 - 175
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
22912744 2012 The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME.
21931564 2011 A genome-wide metabolic QTL analysis in Europeans implicates two loci shaped by recent positive selection.
21269460 2011 Initial characterization of the human central proteome.
20383145 2010 Genetic loci influencing kidney function and chronic kidney disease.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18951093 2008 Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12659830 2003 Identification of CGI-121, a novel PRPK (p53-related protein kinase)-binding protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.