Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.400 1.7e-03
ductal carcinoma in situ -2.300 2.8e-02
ependymoma 1.100 1.7e-05
intraductal papillary-mucinous neoplasm ... 2.700 9.8e-03
lung carcinoma -1.400 3.6e-19
nasopharyngeal carcinoma -1.300 1.3e-02
non-small cell lung cancer 1.368 1.2e-03
ovarian cancer -1.800 5.9e-04
pancreatic cancer 1.600 2.4e-04
ulcerative colitis 1.100 1.2e-03

Gene RIF (1)

AA Sequence

MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATR      1 - 70
PGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLICKYDFIMLSCVQLQRIPL     71 - 140
SAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTSEKFLEIC    141 - 210
KLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF         211 - 275
//

Text Mined References (6)

PMID Year Title