Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 6.9e-06
Atopic dermatitis -1.400 1.7e-03
non-small cell lung cancer 1.368 1.2e-03
intraductal papillary-mucinous neoplasm ... 2.700 9.8e-03
pancreatic cancer 1.600 2.4e-04
nasopharyngeal carcinoma -1.300 1.3e-02
lung carcinoma -1.400 3.6e-19
ductal carcinoma in situ -2.300 2.8e-02
ulcerative colitis 1.100 1.2e-03
ovarian cancer -1.800 5.9e-04

Gene RIF (1)

PMID Text
19475631 Meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATR      1 - 70
PGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLICKYDFIMLSCVQLQRIPL     71 - 140
SAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTSEKFLEIC    141 - 210
KLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF         211 - 275
//

Text Mined References (5)

PMID Year Title
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
19475631 2010 Non-replication of association for six polymorphisms from meta-analysis of genome-wide association studies of Parkinson's disease: large-scale collaborative study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.