Property Summary

NCBI Gene PubMed Count 56
PubMed Score 130.88
PubTator Score 306.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
gastric cancer -1.300 5.3e-03
pancreatic cancer -1.200 1.2e-02
Waldenstrons macroglobulinemia 1.150 4.1e-02
Multiple myeloma 1.598 7.8e-04
astrocytoma 1.300 1.3e-02
ependymoma 1.500 2.1e-03
oligodendroglioma 1.400 7.4e-03
permanent atrial fibrillation -1.300 1.3e-02
psoriasis -2.500 1.2e-03
osteosarcoma 2.339 2.3e-07
atypical teratoid / rhabdoid tumor 1.900 1.5e-04
glioblastoma 2.000 2.9e-03
group 4 medulloblastoma 1.900 2.3e-05
medulloblastoma, large-cell 2.500 1.1e-04
primitive neuroectodermal tumor 1.500 1.4e-04
Atopic dermatitis -1.100 6.5e-05
pancreatic ductal adenocarcinoma liver m... 2.599 8.6e-03
intraductal papillary-mucinous adenoma (... 1.700 6.5e-04
intraductal papillary-mucinous carcinoma... 1.500 2.8e-03
lung cancer 1.400 2.7e-02
pediatric high grade glioma 1.400 5.9e-03
pancreatic carcinoma -1.200 1.2e-02
acute myeloid leukemia 1.700 1.3e-02
lung adenocarcinoma 1.178 8.3e-03
Pick disease 1.800 2.3e-05
Breast cancer -1.100 9.4e-06
ovarian cancer 2.900 3.8e-09
Gaucher disease type 1 -1.800 1.4e-02

 MGI Phenotype (1)

Gene RIF (23)

PMID Text
26094769 SLK interacts with Tpr and alpha-actinin-4 in cells, and these protein-protein interactions may control the subcellular localization and the biological activity of SLK.
25789545 Report mutual regulation between Tpr and Aurora A and further confirm the importance of nucleoporin function in spindle pole organization, bipolar spindle assembly, and mitosis.
25744187 Tpr maintains a chromatin environment favourable for HIV replication.
25731161 Knockdown of translocated promoter region (to activated MET oncogene) (TPR) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
25631074 Cellular biotinylated nucleoprotein TPR is incorporated into HIV-1 Gag virus-like particles
24938596 Protein kinase A phosphorylates the S2094 residue and that the site is hyperphosphorylated during mitosis.
24722547 analysis of interactions between CRM1 and the nuclear pore protein Tpr and snurportin
24344181 Tpr is a kinetochore-independent, rate-limiting factor required to mount and sustain a robust SAC response.
23649804 Tpr import is mediated by the most abundant import receptor, KPNA2, which binds the bipartite NLS in Tpr with nanomolar affinity
23170199 Tpr depletion increased p53 nuclear accumulation and facilitated autophagy.
23110726 Cellular biotinylated nucleoprotein TPR is incorporated into HIV-1 Gag virus-like particles
22619110 Exon 23 of the translocated promoter region gene was fused to exon 13 of FGFR1 resulting in 8p11 myeloproliferative syndrome.
22253824 Perinuclear localization of Tpr at the nucleopore complex is crucial for regulating intron containing mRNA export.
21811608 Depletion of Tpr by RNA interference triggers G0-G1 arrest and ultimately induces a senescent-like phenotype dependent on the presence of p53.
21613532 Tpr plays an important role in quality control of mRNA trafficked on the Nxf1 pathway.
20407419 Tpr has a role as a determinant of perinuclear organization, with a direct role in forming a morphologically distinct nuclear sub-compartment and delimiting heterochromatin distribution
20237496 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of translocated promoter region (to activated MET oncogene) (TPR) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18981471 Tpr regulates Mad1-Mad2 proteins are regulated during the cell cycle and mitotic spindle checkpoint signaling.
18663750 candidate target gene TPR within 1q and 22q that are potentially important in the pathogenesis of intracranial pediatric ependymomas.
17897941 HSP mRNA export escapes stress inhibition via HSF1-mediated recruitment of the nuclear pore-associating protein TPR to HSP genes, functionally connecting the first and last nuclear steps of the gene expression
15229283 model in which Tpr constitutes the central architectural element that forms the scaffold of the nuclear basket
11952838 results indicate that Tpr plays a critical role in the intranuclear dynamics of RNA pol II transcripts, including the processing, intranuclear transport and targeting, as well as their translocation through the NPC in mammalian cells

AA Sequence

MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVN      1 - 70
ETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEELEAEKRDLIRTNERLSQELEY     71 - 140
LTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYREKRLEQEKELLHSQNTWLNTELKTKTDELLA    141 - 210
LGREKGNEILELKCNLENKKEEVSRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELN    211 - 280
AHIKLSNLYKSAADDSEAKSNELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLE    281 - 350
KELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN    351 - 420
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSSVLERDNRRME    421 - 490
IQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSYRNIEELQQQNQRLLVALREL    491 - 560
GETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQMQLVDSIVRQRDMYRILLSQTTGVAIPLHA    561 - 630
SSLDDVSLASTPKRPSTSQTVSTPAPVPVIESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKL    631 - 700
QEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGA    701 - 770
NEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ    771 - 840
IEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKEIATLKQHLSN    841 - 910
MEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTSNVEQYQAMVTSLEESLNKEK    911 - 980
QVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEA    981 - 1050
LQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKA   1051 - 1120
ESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEG   1121 - 1190
KSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE   1191 - 1260
ELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEKKLLEE   1261 - 1330
DVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLK   1331 - 1400
EDLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQYEELKAQQDKVMETSAQSSGDHQEQH   1401 - 1470
VSVQEMQELKETLNQAETKSKSLESQVENLQKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEE   1471 - 1540
QLRQQITEKEEKTRKAIVAAKSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKSQYEGRI   1541 - 1610
SRLERELREHQERHLEQRDEPQEPSNKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSK   1611 - 1680
VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPVFGSTSGSVRS   1681 - 1750
TSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSSNIVEVVQSSPVERPSTSTAVFGTVS   1751 - 1820
ATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLKSVTPVGTEEEVMAEESTDGEVETQVYNQDS   1821 - 1890
QDSIGEGVTQGDYTPMEDSEETSQSLQIDLGPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDG   1891 - 1960
EHEDYEEDEEDDDDDEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGEGNHR   1961 - 2030
AADSQNSGEGNTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR   2031 - 2100
IQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAGVPRFRFGPPE   2101 - 2170
DMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAAPVTVFTESTTSDASEHASQS   2171 - 2240
VPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSS   2241 - 2310
SSVDTSSSQPKPFRRVRLQTTLRQGVRGRQFNRQRGVSHAMGGRGGINRGNIN                    2311 - 2363
//

Text Mined References (75)

PMID Year Title
26094769 2015 Identification of Tpr and ?-actinin-4 as two novel SLK-interacting proteins.
25789545 2015 Therapeutic potential of mitotic interaction between the nucleoporin Tpr and aurora kinase A.
25744187 2015 Chromatin organization at the nuclear pore favours HIV replication.
24970816 2014 The subcellular distribution and function of MTA1 in cancer differentiation.
24938596 2014 Phosphorylation of nucleoporin Tpr governs its differential localization and is required for its mitotic function.
24722547 2014 The interaction of CRM1 and the nuclear pore protein Tpr.
24581499 2014 Nuclear pores protect genome integrity by assembling a premitotic and Mad1-dependent anaphase inhibitor.
24344181 2013 Spindle assembly checkpoint robustness requires Tpr-mediated regulation of Mad1/Mad2 proteostasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23649804 2013 Defective nuclear import of Tpr in Progeria reflects the Ran sensitivity of large cargo transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23170199 2012 Regulation of autophagy by nucleoporin Tpr.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22619110 2012 Identification of a novel partner gene, TPR, fused to FGFR1 in 8p11 myeloproliferative syndrome.
22401879 2012 The health benefits of dietary fiber: beyond the usual suspects of type 2 diabetes mellitus, cardiovascular disease and colon cancer.
22253824 2012 Localization of nucleoporin Tpr to the nuclear pore complex is essential for Tpr mediated regulation of the export of unspliced RNA.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21811608 2011 Silencing nuclear pore protein Tpr elicits a senescent-like phenotype in cancer cells.
21613532 2011 The Tpr protein regulates export of mRNAs with retained introns that traffic through the Nxf1 pathway.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20407419 2010 Protein Tpr is required for establishing nuclear pore-associated zones of heterochromatin exclusion.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20133940 2010 Nucleoporin translocated promoter region (Tpr) associates with dynein complex, preventing chromosome lagging formation during mitosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19835572 2009 Karyopherin binding interactions and nuclear import mechanism of nuclear pore complex protein Tpr.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19273613 2009 Spatiotemporal control of mitosis by the conserved spindle matrix protein Megator.
18981471 2008 Tpr directly binds to Mad1 and Mad2 and is important for the Mad1-Mad2-mediated mitotic spindle checkpoint.
18794356 2008 Extracellular signal-regulated kinase 2 (ERK2) phosphorylation sites and docking domain on the nuclear pore complex protein Tpr cooperatively regulate ERK2-Tpr interaction.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18663750 2008 Real-time quantitative PCR analysis of pediatric ependymomas identifies novel candidate genes including TPR at 1q25 and CHIBBY at 22q12-q13.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17897941 2007 HSF1-TPR interaction facilitates export of stress-induced HSP70 mRNA.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17098863 2006 ELYS is a dual nucleoporin/kinetochore protein required for nuclear pore assembly and proper cell division.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15654337 2005 Polyglutamine expansion of huntingtin impairs its nuclear export.
15635413 2005 Nucleolar proteome dynamics.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15229283 2004 Nucleoporins as components of the nuclear pore complex core structure and Tpr as the architectural element of the nuclear basket.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12802065 2003 Direct interaction with nup153 mediates binding of Tpr to the periphery of the nuclear pore complex.
12594221 2003 Identification of novel ERK2 substrates through use of an engineered kinase and ATP analogs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424524 2002 The evolutionarily conserved single-copy gene for murine Tpr encodes one prevalent isoform in somatic cells and lacks paralogs in higher eukaryotes.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
11952838 2002 Nucleocytoplasmic transport of proteins and poly(A)+ RNA in reconstituted Tpr-less nuclei in living mammalian cells.
11896612 2002 Use of signal specific receptor tyrosine kinase oncoproteins reveals that pathways downstream from Grb2 or Shc are sufficient for cell transformation and metastasis.
11839768 2002 Tpr is localized within the nuclear basket of the pore complex and has a role in nuclear protein export.
11514627 2001 Amino acid substitutions of coiled-coil protein Tpr abrogate anchorage to the nuclear pore complex but not parallel, in-register homodimerization.
11248057 2001 The nucleoporin Nup98 associates with the intranuclear filamentous protein network of TPR.
10708513 2000 A 6-Mb high-resolution physical and transcription map encompassing the hereditary prostate cancer 1 (HPC1) region.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
9864356 1998 Functional analysis of Tpr: identification of nuclear pore complex association and nuclear localization domains and a role in mRNA export.
9828100 1998 Molecular segments of protein Tpr that confer nuclear targeting and association with the nuclear pore complex.
9024684 1997 Identification of protein p270/Tpr as a constitutive component of the nuclear pore complex-attached intranuclear filaments.
7851906 1994 Refined localization of the human TPR gene to chromosome 1q25 by in situ hybridization.
7798308 1994 Tpr, a large coiled coil protein whose amino terminus is involved in activation of oncogenic kinases, is localized to the cytoplasmic surface of the nuclear pore complex.
3821733 1987 Characterization of the rearranged tpr-met oncogene breakpoint.
3387099 1988 tpr homologues activate met and raf.
3277171 1988 Characterization of the TPR-MET oncogene p65 and the MET protooncogene p140 protein-tyrosine kinases.
2300559 1990 TPR-MET oncogenic rearrangement: detection by polymerase chain reaction amplification of the transcript and expression in human tumor cell lines.
1611909 1992 Localization of the 5' end of the MCF2 oncogene to human chromosome 15q15----q23.
1549355 1992 Nucleotide sequence analysis of human tpr cDNA clones.
1532241 1992 TRK-T1 is a novel oncogene formed by the fusion of TPR and TRK genes in human papillary thyroid carcinomas.
1437155 1992 The human tpr gene encodes a protein of 2094 amino acids that has extensive coiled-coil regions and an acidic C-terminal domain.