Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.03
PubTator Score 5.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
CREST Syndrome 16 4.427 2.2
Telangiectasis 36 3.121 1.6

Expression

AA Sequence

MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQF      1 - 70
KEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKG     71 - 140
KGIAGREEMTDNTGYVSGYKGSGTYDKKTK                                            141 - 170
//

Text Mined References (8)

PMID Year Title