Property Summary

NCBI Gene PubMed Count 43
PubMed Score 86.52
PubTator Score 594.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.600 1.4e-02
posterior fossa group A ependymoma -2.000 1.9e-11
cutaneous lupus erythematosus -1.800 4.4e-04
psoriasis -2.600 1.3e-70
glioblastoma -3.400 7.8e-06
oligodendroglioma -1.900 9.5e-10
group 4 medulloblastoma -5.100 5.9e-13
atypical teratoid / rhabdoid tumor -4.600 8.9e-10
medulloblastoma, large-cell -5.300 8.8e-08
primitive neuroectodermal tumor -2.800 5.0e-06
non-small cell lung cancer -1.779 6.1e-14
intraductal papillary-mucinous adenoma (... 1.500 2.7e-03
lung cancer -3.800 1.6e-06
pediatric high grade glioma -3.200 3.2e-08
pilocytic astrocytoma -2.600 3.0e-11
acute myeloid leukemia -1.200 4.6e-02
subependymal giant cell astrocytoma -3.188 9.0e-03
nasopharyngeal carcinoma -2.000 8.8e-08
Breast cancer -2.200 3.0e-12
ductal carcinoma in situ -1.200 2.0e-03
chronic rhinosinusitis -1.839 1.0e-02

Gene RIF (32)

PMID Text
26317805 Results reveal a link between p25 and BACE1 in Alzheimer disease (AD) brains and suggest that upregulated Cdk5 activation by p25 accelerates AD pathogenesis by enhancing BACE1 activity via phosphorylation.
26289831 the central folded domain of TPPP/p25 following binding to microtubules can drive s homotypic protein-protein interactions leading to bundled microtubules.
25445539 suggest that the zinc as a specific divalent cation could be involved in the fine-tuning of the physiological TPPP/p25 level counteracting both the enrichment and the lack of this protein leading to distinct central nervous system diseases
24655651 Epigenetic changes in TPPP, in combination with experiences of maltreatment, may confer risk for depression in children.
23727580 results suggest that ROCK regulates beta-catenin stability in cells via preventing TPPP1-mediated inhibition of HDAC6 activity, to reduce its acetylation and degradation via phosphorylation by CK1 and GSK3beta
23355470 dual Rock and Cdk phosphorylation of Tppp1 inhibits its regulation of the cell cycle to increase cell proliferation
23161404 GSK3 promotes the mitochondrial translocation of p53, enabling its interaction with Bcl2 to allow Bax oligomerization and the subsequent release of cytochrome C.
22328514 The RhoA-ROCK-LIMK2-TPPP pathway controls metaphase spindle-orientation; TPPP colocalizes with LIMK2 at the mitotic spindle.
22326478 The authors conclude that the modest structural changes that p25alpha undergoes can promote weak intermolecular contacts and that polyanions such as heparin play a central role in stabilizing these aggregates.
22083140 Wnt induces the phosphorylation of LRP6 which consequently access the catalytic pocket of GSK3 as pseudo-substrates, thus directly blocking its activity against beta-catenin.
21995432 Binding of Zn(2) bivalent cation to structurally disordered TPPP/p25 influences TPPP/p25-promoted tubulin polymerization and GTPase activity.
21900749 GSK3 has a significant role in maintaining repression of growth factor-inducible genes during quiescence. CREB, NFkB and AP-1 mediate this regulation of gene expression by GSK-3.
21857997 Data show that TPPP may work as a protective factor for cells against the damage effects of the accumulation of abnormal forms of PrPs, besides its function as an agent for dynamic stabilization of microtubular ultrastructures.
21832049 Interactions of pathological hallmark proteins: tubulin polymerization promoting protein/p25, beta-amyloid, and alpha-synuclein.
21616478 This study demonistrated that p25 is generated during spatial memory formation.
21565174 these investigations suggest the CSF-TPPP/p25 level could become diagnostic marker of MS and other demyelination-related diseases.
20849899 Although serine-129 phosphorylation of alpha-synuclein facilitates TPPP-mediated alpha-SYN oligomerization, this modification does not seem to play an inevitable role in the early step of alpha-SYN oligomer formation in a cellular model of multiple system atrophy.
20308065 TPPP/p25 promotes tubulin acetylation by inhibiting histone deacetylase 6
19698783 The RING domain of XIAP (and probably cIAP-1 and cIAP-2) associates with GSK3, GSK3 acts upstream of the apoptosome to promote intrinsic apoptosis, and the association between XIAP and GSK3 may block the pro-apoptotic function of GSK3.
19382230 Data suggest that the intracellular level of TPPP/p25 influences the cell differentiation, proliferation and the formation of protein aggregates, and consequently, the etiology of central nervous system diseases.
18854154 Knockdown of tubulin polymerization promoting protein (TPPP) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18728964 contribution of GSK3 in growth regulation of myeloma cells
18311157 GSK-3 is involved in the regulation of, and cross-talk between, two major forms of synaptic plasticity, N-methyl-D-aspartate receptor dependent long-term potentiation and NMDAR-dependent long-term depression--REVIEW
18204489 we review evidence pertaining to the role of GSK3 in the myocardium and discuss effects of genetic manipulation of GSK3 activity in vivo--REVIEW
18028908 LIMK1 phosphorylation of p25 blocks p25 activity, thus promoting microtubule disassembly.
18025801 data suggest that gain of 5p15.33 (TPPP and ZDHHC11) may become a potential biomarker identifying high-risk patients with disease progression in bladder cancer.
17823288 Myelin basic protein and p25alpha colocalize in myelin in normal human brains.
17693641 ERK2 can regulate TPPP activity via the phosphorylation of Thr(14) and/or Ser(18) in its unfolded N-terminal tail
17027006 identified glyceraldehyde-3-phosphate dehydrogenase (GAPDH) as a new interacting partner of TPPP/p25 within the alpha-synuclein positive Lewy body
16879710 Recombinant TPPP plays an important role for tubulin-related transport in developing, myelinating oligodendrocytes.
15590652 perhaps p25alpha plays a pro-aggregatory role in the common neurodegenerative disorders hall-marked by alpha-synuclein aggregates
15564385 TPPP/p25 has a role in stabilization of physiological microtubular ultrastructures and cell survival

AA Sequence

MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGRE      1 - 70
MHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREV     71 - 140
HRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGT    141 - 210
YDQKVQGGK                                                                 211 - 219
//

Text Mined References (48)

PMID Year Title
26317805 2015 Enhancement of BACE1 Activity by p25/Cdk5-Mediated Phosphorylation in Alzheimer's Disease.
26289831 2015 Self protein-protein interactions are involved in TPPP/p25 mediated microtubule bundling.
25445539 2015 Zinc-induced structural changes of the disordered tppp/p25 inhibits its degradation by the proteasome.
24655651 2014 Child abuse, depression, and methylation in genes involved with stress, neural plasticity, and brain circuitry.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23727580 2013 Tubulin polymerization promoting protein 1 (TPPP1) increases ?-catenin expression through inhibition of HDAC6 activity in U2OS osteosarcoma cells.
23355470 2013 Tubulin polymerization promoting protein 1 (Tppp1) phosphorylation by Rho-associated coiled-coil kinase (rock) and cyclin-dependent kinase 1 (Cdk1) inhibits microtubule dynamics to increase cell proliferation.
23161404 2013 Pharmacological inhibition of GSK3 attenuates DNA damage-induced apoptosis via reduction of p53 mitochondrial translocation and Bax oligomerization in neuroblastoma SH-SY5Y cells.
22328514 2012 TPPP acts downstream of RhoA-ROCK-LIMK2 to regulate astral microtubule organization and spindle orientation.
22326478 2012 Multiple roles of heparin in the aggregation of p25?.
22083140 2011 Inhibition of GSK3 by Wnt signalling--two contrasting models.
21995432 2011 Zn²+-induced rearrangement of the disordered TPPP/p25 affects its microtubule assembly and GTPase activity.
21900749 2011 A GSK-3-mediated transcriptional network maintains repression of immediate early genes in quiescent cells.
21857997 2011 Molecular interaction of TPPP with PrP antagonized the CytoPrP-induced disruption of microtubule structures and cytotoxicity.
21832049 2011 Interactions of pathological hallmark proteins: tubulin polymerization promoting protein/p25, beta-amyloid, and alpha-synuclein.
21616478 2011 Cyclin-dependent kinase 5 activator p25 is generated during memory formation and is reduced at an early stage in Alzheimer's disease.
21565174 2011 A new myelin protein, TPPP/p25, reduced in demyelinated lesions is enriched in cerebrospinal fluid of multiple sclerosis.
20849899 2010 Role of TPPP/p25 on ?-synuclein-mediated oligodendroglial degeneration and the protective effect of SIRT2 inhibition in a cellular model of multiple system atrophy.
20308065 2010 TPPP/p25 promotes tubulin acetylation by inhibiting histone deacetylase 6.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19698783 2009 XIAP associates with GSK3 and inhibits the promotion of intrinsic apoptotic signaling by GSK3.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19382230 2009 An unstructured protein with destructive potential: TPPP/p25 in neurodegeneration.
18728964 2008 Growth control of multiple myeloma cells through inhibition of glycogen synthase kinase-3.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18311157 2008 The role of GSK-3 in synaptic plasticity.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18204489 2008 Glycogen synthase kinase 3 (GSK3) in the heart: a point of integration in hypertrophic signalling and a therapeutic target? A critical analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18028908 2007 The phosphorylation of p25/TPPP by LIM kinase 1 inhibits its ability to assemble microtubules.
18025801 2007 Gain of 5p15.33 is associated with progression of bladder cancer.
17823288 2007 p25alpha relocalizes in oligodendroglia from myelin to cytoplasmic inclusions in multiple system atrophy.
17693641 2007 Phosphorylation blocks the activity of tubulin polymerization-promoting protein (TPPP): identification of sites targeted by different kinases.
17105200 2006 Tubulin polymerization promoting proteins (TPPPs): members of a new family with distinct structures and functions.
17027006 2006 Interaction of TPPP/p25 protein with glyceraldehyde-3-phosphate dehydrogenase and their co-localization in Lewy bodies.
16879710 2006 P25alpha/Tubulin polymerization promoting protein expression by myelinating oligodendrocytes of the developing rat brain.
15822905 Phosphoproteomic analysis of synaptosomes from human cerebral cortex.
15590652 2005 p25alpha Stimulates alpha-synuclein aggregation and is co-localized with aggregated alpha-synuclein in alpha-synucleinopathies.
15564385 2004 Dynamic targeting of microtubules by TPPP/p25 affects cell survival.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623963 2003 TPPP/p25 promotes tubulin assemblies and blocks mitotic spindle formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12093283 2002 Brain-specific p25 protein binds to tubulin and microtubules and induces aberrant microtubule assemblies at substoichiometric concentrations.
11781156 2002 P24, a glycogen synthase kinase 3 (GSK 3) inhibitor.
10083737 1999 A novel human gene whose product shares significant homology with the bovine brain-specific protein p25 on chromosome 5p15.3.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.