Property Summary

NCBI Gene PubMed Count 32
PubMed Score 33.30
PubTator Score 24.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (7)

PMID Text
23812729 Data indicate the upregulation of tropomyosin-4 in infiltrating ductal breast carcinomas (IDCAs) tissues, which may suggest its involvement in breast cancer development.
23792823 In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls.
22537621 Plasma peroxiredoxins 1 and 2, and tropomyosin 4 were shown to associate with asbestos-exposure, and peroxiredoxin 1 with lung cancer.
21373848 TPM4, PDIA and SRC8 were also localized to the trophoblast cells, further highlighting the importance of these cytoskeletal remodelling proteins in early pregnancy
21119665 Low TPM4 expression in the cytoplasm is associated with uterine cervix carcinogenesis.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
17968984 Tm4-defined cytoskeleton is a marker of growth and repair/regeneration in response to injury, disease state and stress in skeletal muscle.

AA Sequence

MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERL      1 - 70
ATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGEL     71 - 140
ERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTV    141 - 210
AKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI                                    211 - 248
//

Text Mined References (40)

PMID Year Title
25369766 2015 A systematic nomenclature for mammalian tropomyosin isoforms.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23812729 2013 Tropomyosin-4 correlates with higher SBR grades and tubular differentiation in infiltrating ductal breast carcinomas: an immunohistochemical and proteomics-based study.
23792823 2013 Protein isoform-specific validation defines multiple chloride intracellular channel and tropomyosin isoforms as serological biomarkers of ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22537621 2012 Peroxiredoxins and tropomyosins as plasma biomarkers for lung cancer and asbestos exposure.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21373848 2011 Cytoskeletal remodelling proteins identified in fetal-maternal interface in pregnant women and rhesus monkeys.
21269460 2011 Initial characterization of the human central proteome.
21119665 2011 Differential expression of ANXA6, HSP27, PRDX2, NCF2, and TPM4 during uterine cervix carcinogenesis: diagnostic and prognostic value.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17968984 2008 Tropomyosin 4 defines novel filaments in skeletal muscle associated with muscle remodelling/regeneration in normal and diseased muscle.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16551573 2006 AROS-29 is involved in adaptive response to oxidative stress.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236705 2005 h2-Calponin is regulated by mechanical tension and modifies the function of actin cytoskeleton.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627618 2003 Smooth muscle contraction and relaxation.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11782456 2002 Members of the Zyxin family of LIM proteins interact with members of the p130Cas family of signal transducers.
11493472 2001 Unusual childhood extramedullary hematologic malignancy with natural killer cell properties that contains tropomyosin 4--anaplastic lymphoma kinase gene fusion.
10934142 2000 TPM3-ALK and TPM4-ALK oncogenes in inflammatory myofibroblastic tumors.
8641132 1996 Assignment of the human alpha-tropomyosin gene TPM4 to band 19p13.1 by fluorescence in situ hybridization.
3865200 1985 A muscle-type tropomyosin in human fibroblasts: evidence for expression by an alternative RNA splicing mechanism.
3612796 1987 Characterization of a cDNA defining a gene family encoding TM30p1, a human fibroblast tropomyosin.
1836432 1991 The calcium binding protein tropomyosin in human platelets and cardiac tissue: elevation in hypertensive cardiac hypertrophy.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.