Property Summary

NCBI Gene PubMed Count 24
PubMed Score 34.42
PubTator Score 28.32

Knowledge Summary

Patent (4,586)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
substance-related disorder 156 0.0 0.7
Disease Target Count Z-score Confidence
Leigh disease 100 3.386 1.7

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.524 1.0e-02
active ulcerative colitis 1.473 4.6e-03
astrocytic glioma -1.500 2.7e-02
ependymoma -1.700 2.7e-02
intraductal papillary-mucinous adenoma (... 1.300 1.0e-02
intraductal papillary-mucinous carcinoma... 1.600 2.4e-02
lung cancer -2.800 6.1e-06
medulloblastoma, large-cell -1.700 1.1e-04
non-small cell lung cancer -1.424 3.9e-16
oligodendroglioma -1.700 1.5e-02
osteosarcoma -1.357 9.2e-03
ovarian cancer -1.500 5.3e-06
primitive neuroectodermal tumor -1.400 1.9e-02
pterygium -1.100 1.5e-03
subependymal giant cell astrocytoma 3.082 1.6e-02
tuberculosis 1.900 1.0e-06
urothelial carcinoma -1.200 2.5e-02

 GWAS Trait (2)

Gene RIF (9)

AA Sequence

MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING      1 - 70
DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN     71 - 140
TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLA    141 - 210
FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS                                         211 - 243
//

Text Mined References (25)

PMID Year Title