Property Summary

NCBI Gene PubMed Count 77
PubMed Score 742.78
PubTator Score 724.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 32 0.0 4.0

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 2.9e-03
Breast cancer 1.300 8.1e-06
intraductal papillary-mucinous neoplasm ... 1.300 1.2e-03
lung adenocarcinoma 1.037 1.2e-07
lung cancer 1.700 4.5e-05
Multiple myeloma 1.446 3.1e-04
non-small cell lung cancer 1.261 5.0e-30
ovarian cancer 3.400 1.5e-07

PDB (15)

Gene RIF (37)

AA Sequence

MAEDGEEAEFHFAALYISGQWPRLRADTDLQRLGSSAMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAK      1 - 70
VPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVF     71 - 140
GESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGT    141 - 210
GKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVD    211 - 280
IINAKQ                                                                    281 - 286
//

Text Mined References (96)

PMID Year Title