Property Summary

NCBI Gene PubMed Count 238
PubMed Score 295.59
PubTator Score 365.48

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (295)

PMID Text
26583347 We also found that early family structure directly influences the levels of dysregulation problems in early adolescence, both alone and in interaction with TPH2.
26497913 loss of function mutation in Tph2 results in greater motivation for ethanol consumption under aversive conditions and may confer enhanced sensitivity to alcohol use disorder
26386440 Chinese Han individuals with at least oners11178997T allele or rs120074175A allele are susceptible to MD even in the relative absence of high-negative life events.
26232682 A potential role of TPH2 in alcohol dependencies suggested. TPH2 genetic variability may be also associated with anxiety and aggression traits in alcohol dependent subjects.
26071405 1,25-Dihydroxyvitamin D regulates expression of the tryptophan hydroxylase 2 and leptin genes: implication for behavioral influences of vitamin D.
26057341 TPH2 polymorphism may be associated with cognitive function in late onset depression patients.
26028568 results provide evidence for an association between the rs7305115 polymorphism of the TPH-2 gene and suicidal behavior in a Mexican population.
26013962 Study demonstrated that 5-HTTLPR, VNTR In2, and TPH2 rs1386497 polymorphisms mediate working memory performance and that their effects on working memory depend on cocaine use of participants
26001668 mood disorders and HTR1A G allele variation, the C-1019G polymorphism of the transcriptional control region of the 5-HT1A receptor, independently predicted the incidence of IFN-induced depression in HCV patients
25955598 TPH2 expression is regulated by DNA methylation of the TPH2 promoter region in patients with major depressive disorder.
25455586 results provide evidence on the possible role of genetic variations in 5-HT neurotransmission on development of personality traits, and suggest a functional interaction between two key proteins in the serotonergic system.
25451452 Carriers of the TPH-2 allele may be at increased risk for PTSD. COMT rs4633C and TPH-2 rs11178997T alleles jointly explained 7% of the variance in PTSD severity scores. These findings provide biological support for dividing DSM-IV category C symptoms into DSM-5 categories C and D.
25283578 genetic contribution to phenotypic facets related to obsessive-compulsive symptoms and perfectionism in healthy subjects; association of TPH2 s4570625 and DRD2 TaqIA SNPs with the subscales scrupulousness and perseverance of the BFQ factor conscientiousness were found
25214390 This study showed that an interaction among childhood abuse and genetic variants of TPH2.
25152196 The results of this study indicated that in the Han Chinese population TPH2 may be a potential susceptibility gene for bipolar disorder. Further studies are needed to validate this association.
25014617 findings support that TPH2 may play an important functional role in the development of PTSD and contribute to the limited literature regarding the genetic basis and the sex-specific expression of PTSD's symptoms
25005534 With regard to G-703 T/A-473 T/G19918A TPH-2 variants, this up-to-date meta-analysis could not detect any significant association between those genetic variants and suicidal behavior .[review and meta-analysis]
24958631 Data show that a marginal association between TPH2 rs11179023 and symptom improvement was observed in only the group of major depressive disorder patients treated with interpersonal counseling.
24942188 findings suggest that greater TPH2 gene expression is the basis for more TPH2 protein in the Dorsal Raphe Nucleus and Median Raphe Nucleus in alcoholics.
24899127 polymorphic tph2 enzyme has increased activity, but decreased enzyme stability and serotonin production
24668623 Our findings suggest that common genetic variations of TPH2 are likely to contribute to genetic susceptibility to paranoid schizophrenia in Han Chinese.
24491795 Tryptophan hydroxylase 2 gene allele variants might be risk factors for psychiatric conditions in TLE [temporal lobe epilepsy ].
24458851 The results of this study showed no association between tryptophan TPH2 gene polymorphisms and the complication of medication overuse headaches in patients with migraines.
24376086 Case-control genetic association study in multi-ethnic Malaysian population. Strong linkage disequilibrium was detected between rs1386495 and rs1386494 in pooled subjects; however, no significant association was found in the haplotype analysis.
24304270 TPH2 variant and maternal stress and depression are associated with difficulty disengaging attention from fearful facial expressions.
24260145 None of the three gene variants, 5-HTTLPR, COMTval158met and TPH2 G-703T, was associated with long-term response to CBT for SAD.
24196946 Results show that a single nucleotide loss of function polymorphism in tph2 is sufficient to induce gene-dose-dependent cognitive deficits in mice
24033289 identified a regulatory site in the TPH2 promoter region that may be important for ER-induced TPH2 transcriptional activity.
23995203 The association between TPH2 and suicide/alcohol-related suicide remain unclear.
23992289 The G allele of rs2129575 of TPH2 is associated with relatively mild clinical symptoms of autism spectrum disorders individuals in our Japanese popula-tion and Korean population
23965265 The findings suggest that genetic variations of COMT and TPH2 have synergistic effects on social cognition in the general population
23716677 Data indicate that tryptophan hydroxylase 2 Tph2-/- and LIM homeobox transcription factor 1 beta Lmx1b-/- females displayed a change in sexual preference.
23684859 correlation between amygdala-hippocampus connectivity and Gray's trait anxiety scores is positive in individuals homozygous for the TPH2 G-allele, while carriers of at least one T-allele show a negative association.
23628433 results of the present study indicate likely involvement of ITGB3 and TPH2 in the pathophysiology of ASD in the Indian population.
23552096 The results of this study concluded that rs4570625 (-703 G/T), rs2129575 and rs1386491 play a significant role in GABAergic neurotransmission and may contribute to the sex-specific dysfunction of the GABAergic system in the Prefrontal cortex.
23467366 This studty the Tph2KI mice carrying the Tph2(R439H) allele exhibit an increase in AMY-mPFC delta synchrony.
23461725 These results suggested that TPH2 gene polymorphisms might be related to attention deficit hyerpactivity disorder (ADHD) symptoms in Korean children.
23360517 Our results indicated that the TPH2 genotype of rs4565946 is a potential genetic risk factor for tic disorder
23334703 Frontal lobe symptoms are significantly associated with TPH2 polymorphisms in Alzheimer's disease patients.
23313272 None of the genetic markers within SLC6A4, MAOA, TPH1 and TPH2 were significantly associated with completed suicide or suicide method in the basic association tests.
23258345 The main finding was that carriers homozygous for the G allele(TPH2 -703 G/T) showed increased target-related induced gamma-band synchronization when combined with the A/A genotype of the (NE) transporter variation.
23247084 A family-based study found no association between the TPH2 (rs4570625 and rs11178997)polymorphisms and attention deficit hyperactivity disorder, and, therefore, does not support the earlier reports that described a significant association.
23239044 Genetic variation at the TPH2 gene appears to affect impulsivity which, in turn, might predispose to the self-induced vomiting eating disorder phenotype
23182718 Data indicate that the C-terminal domain was the immunodominant part of tryptophan hydroxylase TPH1, the epitopes of tryptophan hydroxylase TPH2 and tyrosine hydroxylase (TH) were mainly located in the N-terminal regulatory domains.
23032942 Tryptophan hydroxylase has been implicated in impulsivity, aggression and suicidal behavior.
22915309 the association of risk for psychiatric disorders with a common TPH2 yin haplotype is related to the inefficient functional engagement of cortical areas involved in cognitive control and alterations in the mode of functional connectivity of dACC pathways.
22868061 The present study indicates an association between TPH2 and depressive symptoms that is conditional on prior experience of stressful life events. Further evidence is provided about the role of the environment in genetic vulnerability to depression.
22835848 findings suggest that rs4570625 and rs4565946 polymorphisms in TPH2 gene are involved in development of poststroke anxiety in the Han Chinese population.
22721547 This study showed evidence that genotypes in THP2 have some influence on depressive symptoms in women during and after pregnancy
22698779 These results suggest that TPH2 polymorphisms enhance autism spectrum disorder susceptibility.
22698518 These data showing the association of polymorphisms in the TPH2 and MTNR1B genes with the progressive subtypes of multiple sclerosis and disability suggest dysregulation in melatonin pathway
22693556 relationship between TPH2 SNPs and major depression
22655589 The results of this study reveled that only a minor role of TPH2 haplotypes for schizophrenia.
22649797 Genetic variation in TPH2 was associated with both anger and gray matter concentration in the inferior orbitofrontal cortex and hippocampus.
22491354 An involvement was found for functional Tph2 polymorphisms in anxiety-related behaviors.
22483952 variants in the TPH2 gene contributes to risk factors for post traumatic stress disorder symptoms.
22392150 The common variants within TPH2 promoter are associated with paranoid schizophrenia in Han Chinese.
22365257 the association between TPH2,CO2 reactivity and panic symptoms induced by carbon dioxide in healthy individuals
22361444 This study failed to support the tryptophan hydroxylase 2 mutation association to autism spectrum disorders in a Japanese population.
22342331 The results of this study suggested that TPH2 CNVs do not contribute to genetic susceptibility to schizophrenia.
22322887 These results suggest that the TPH2 polymorphism affects appraisal processes in the case of negative emotions.
22072571 We found that polymorphisms in SLC6A4, TPH2, and SERPINA6 appear to be maternal factors increasing the risk of having a child with facial clefts.
21969281 CC genotype of TPH2 rs2171363, GG genotype of TPH2 rs7305115, CC genotype of HTR2A rs2770304, and CC genotype of HTR2A rs6313 were associated with reduced internalizing scores for children born in the birth weight quartile above the midpoint.
21946031 Hopelessness could be a mediating phenotype between the TPH2 gene, depression and suicidal behavior.
21873838 results support the hypothesis that the TPH2 gene is associated with Late-onset depression.
21829912 Our research has not demonstrated the existence of associations between the eight SNPs of TPH2 and obsessive-compulsive disorder.
21747395 results suggest that in humans, genetic factors might partly account for variations in serotonin synthesis in the OBFC.
21621273 No differences in genotype distribution in TPH2 SNPs was found between patients with and without suicide attempts.
21620479 result suggests that TPH2 gene may have a gender dependent effect on susceptibility to MDD but not with its treatment response in Chinese Han population
21457069 The present study suggests that TPH2 contributes distinctively to the inhibition domain of executive function in young Chinese Han population.
21418063 Allelic variation in the promoter region of a gene that encodes tryptophan hydroxylase isoform 2 (TPH2)has been associated with variations in cognitive function and vulnerability to affective spectrum disorders.
21418060 TPH2 G/T polymorphisms, and presumed loss of enzyme function, were associated with specific aspects of the PWS phenotype.
21396719 This study suggested that TPH2 variants neither have a major role in major depression,bipolar disorder and schizophrenia nor in response to treatments.
21257271 Future research on TPH2 will provide an entirely new view of 5-HT in brain development and function related to neuropsychiatric disorders.
21198324 SNP rs1386483 associated with suicide and repeated suicide attempts
21182896 This study suggested implication of TPH2 polymorphisms in suicide and alcohol-related suicide.
21105877 The propensity of TPH2 to misfold upon oxidation of its cysteine residues is responsible for its catalytic lability and may be related to loss of serotonin neuronal function in PD and the emergence of non-motor (psychiatric) symptoms.
21085052 The aim of this study is to investigate a possible association between TPH2 gene polymorphisms and the panic disorder comorbidity susceptibility.
21085052 Observational study of gene-disease association. (HuGE Navigator)
21073637 Results describe associations of tryptophan hydroxylase 1 and 2 gene variants with irritable bowel syndrome-related GI symptoms and stool characteristics.
21073637 Observational study of gene-disease association. (HuGE Navigator)
21049304 Observational study of gene-disease association. (HuGE Navigator)
20946355 tryptophan hydroxylase 2 polymorphism was associated with a higher risk for anorexia nervosa, eating disorders characterized by self-induced vomiting
20946355 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20938755 These results suggest that rs4570625 of tryptophan hydroxylase-2 may play an important role in the development of positive symptoms in Han Chinese schizophrenic patients.
20938755 Observational study of gene-disease association. (HuGE Navigator)
20921119 Family analysis of 38 TPH1 mutation carriers and 41 of their offspring revealed that offspring of mothers carrying TPH1 mutations reported 1.5- to 2.5-times-higher ADHD scores and related symptoms during childhood and as adults than did controls.
20921119 Observational study of gene-disease association. (HuGE Navigator)
20869124 No significant differences were found between the suicide and control groups. Obtained results do not support involvement of the investigated polymorphism in the susceptibility to suicide completion.
20856248 Functional characterization of SNP (rs1386493) and its pathological consequences suggest that the TPH2 gene deserves further attention as a potential risk factor for depression.
20740293 These results suggest a possible influence of genetic variation in TPH2 in the pathogenesis of migraine.
20740293 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20738857 TPH2 rs7305115A remained a significant protective predictor of suicide attempts.
20738857 Observational study of gene-disease association. (HuGE Navigator)
20633049 Observational study of gene-disease association. (HuGE Navigator)
20628266 This study suggests that the TPH2 G-703T polymorphism might contribute to anger-related traits, especially to the expression of anger.
20628266 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20623453 A significant association of A1438G of 5-HTR2A with schizophrenia in Malays, was found. On the other hand, TPH2 polymorphism was not associated with schizophrenia.
20623453 Observational study of gene-disease association. (HuGE Navigator)
20515362 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20470849 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20451217 This study found thatan association between the TPH2 "risk" haplotype and borderline personality disorder diagnosis, affective lability, suicidal/parasuicidal behavior, and aggression scores.
20451217 Observational study of gene-disease association. (HuGE Navigator)
20446882 ASD could be differentiated from ADHD with nominal statistical significance by the 5HTTLPR, and the polymorphisms in TPH2 and CNTNAP2.
20446882 Observational study of gene-disease association. (HuGE Navigator)
20403506 Observational study of gene-disease association. (HuGE Navigator)
20396435 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20331984 subjects with T allele carriers in the Tryptophan hydroxylase gene were associated with significantly smaller volumes in bilateral amygdala and hippocampus and higher reward dependence than those with G allele homozygotes
20331984 Observational study of gene-disease association. (HuGE Navigator)
20213726 In the single largest attention-deficit/hyperactivity disorder (ADHD) genetic study of TPH1 and TPH2 variants presented to date (n = 3,559 individuals), evidence for a substantial effect of common genetic variants on persistent ADHD, was not found.
20213726 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20144688 Neither common genetic variations of TPH1 nor TPH2 are likely to contribute to the genetic susceptibility to schizophrenia in Japanese population.
20144688 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20126463 results strongly suggest a complex fine-tuning of central nervous system 5-HT biosynthesis by TPH2 alternative splicing and RNA editing
20124538 Compared with controls, SIDS was associated with lower 5-HT and TPH2 levels, consistent with a disorder of medullary 5-HT deficiency.
20064585 There was a significant TPH2xsex interaction effect in young adults with male showing stronger overall startle The difference between TPH2 genotype groups also reached significance in the female subsample when including menstrual cycle phase.
20064585 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20052688 Observational study of gene-disease association. (HuGE Navigator)
20043001 our study demonstrates the role of the TPH2 gene and the serotonin system in risk taking and suggests that TPH2 gene may contribute to the expression of psychiatric phenotypes through altered decision making
20043001 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19894072 This study indicated that the effects of 5- HTT and TPH2 variants on cluster B and C personality disorders may likely be modified by stressful life events.
19894072 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19829168 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19816759 The catalytic domains of human tryptophan hydroxylase 1 and 2 have been expressed, purified and the kinetic properties have been studied and are compared.
19800079 The results of this study do not support the association between diagnosis of BD or suicidal behavior and TPH2 polymorphisms.
19781560 Our results did not support our hypothesis of an effect of a TPH2 intron-8 polymorphism (rs1386483) on decision-making.
19781560 Observational study of gene-disease association. (HuGE Navigator)
19763617 TPH2 gene polymorhism is involved in coronary artery lesions in Korean children with Kawasaki disease.
19763617 Observational study of gene-disease association. (HuGE Navigator)
19748542 The result of this study suggested that the common SNPs and haplotypes of the TPH2 gene are unlikely to contribute to the genetic susceptibility to suicidal behavior in Japanese population
19748542 Observational study of gene-disease association. (HuGE Navigator)
19742166 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19734157 Suicide under the influence of alcohol is strongly connected with TPH2 gene.
19734157 Observational study of gene-disease association. (HuGE Navigator)
19693267 Observational study of gene-disease association. (HuGE Navigator)
19679166 This polymorphism may be associated with the severity of treatment-resistant depression.
19679166 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19674121 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19590397 evaluation of association of 7 serotonin signal transduction-linked SNP's [HTR1A (rs6295), HTR2A (rs6313, rs6311 & rs7997012), HTR6 (rs1805054), TPH1 (rs1800532) & TPH2 (rs1386494)] with major depressive disorder; no association found
19590397 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19588223 Observational study of gene-disease association. (HuGE Navigator)
19548263 Observational study of gene-disease association. (HuGE Navigator)
19506906 Meta-analysis of gene-disease association. (HuGE Navigator)
19445671 TPH2 were expressed in all brain regions similarly except for within the striatum and cerebellum, where TPH1 was expressed at a significantly higher level than TPH2.
19434366 Our data argue against a major influence of the TPH2 gene promoter region in migraine.
19434366 Observational study of gene-disease association. (HuGE Navigator)
19365399 Observational study of gene-disease association. (HuGE Navigator)
19361870 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19356604 Data show that no associations are revealed neither on allelic nor haplotype level in 288 suicide completers and 327 volunteers.
19356604 Observational study of gene-disease association. (HuGE Navigator)
19352219 ssociated SNPs are in perfect linkage disequilibrium with SNPs previously associated with bipolar affective disorder (rs4290270) and impulsivity (rs1386483), a core trait of BPAD
19352219 Observational study of gene-disease association. (HuGE Navigator)
19352218 Observational study of gene-disease association. (HuGE Navigator)
19344641 This study aimed to further characterize mechanism(s) by which the hTPH2 5'-UTR regulates gene expression. An internal ribosome entry site (IRES) activity in hTPH2 5'-UTR was suggested by the conventional bicistronic reporter assay.
19328558 Observational study of gene-disease association. (HuGE Navigator)
19319927 Functional effects of all human TPH2 missense variants were studied.
19272410 TPH2 genetic variants may play a role in major depression disorder susceptibility and in acute therapeutic response to selective serotonin reuptake inhibitors.
19272410 Observational study and clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19233335 determination of the neuronal TPH1 and TPH2 protein expression in the anterior pituitary and evidence against a strictly separated duality of the serotonergic system
19184136 Observational study of gene-disease association. (HuGE Navigator)
19181488 In human brsin TPH2 expression was consistently detected in the raphe nuclei.
19175813 TPH2 gene is involved in affective disorders in children.
19175813 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170664 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19162119 The results of this study suggested that TPH2 -703G/T SNP may have an important effect on susceptibility to suicidal behavior.
19162119 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19132526 rs4570625 polymorphism may play a significant role in the pathogenesis of panic disorder
19132526 Observational study of gene-disease association. (HuGE Navigator)
19125211 Observational study of gene-disease association. (HuGE Navigator)
19125159 Our findings suggest that TPH2 polymorphisms characterize a subgroup of depressed patients who are especially prone to develop metabolic disorders induced by a genotype-dependent impairment of serotonergic neurotransmission.
19125159 Observational study of gene-disease association. (HuGE Navigator)
19077664 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19071164 The homozygous carriers of TPH2 -703 G/T polymorphism show decelerated responses in low-conflict conditions.
19071164 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19052197 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19032968 Genotype and allele analyses showed that BPD significantly associated with 5-HT2C and TPH2.
19032968 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19032713 The tryptophan hydroxylase gene influences risk for bipolar disorder but not major depressive disorder.
18937842 Observational study of gene-disease association. (HuGE Navigator)
18832011 We detected significant differences for both genotypic and allelic frequencies of 1386494A/G polymorphism in TPH2 gene between panic and non-panic groups with the frequencies of G/G genotype and G allele significantly higher in panickers.
18832011 Observational study of gene-disease association. (HuGE Navigator)
18826444 Observational study of gene-disease association. (HuGE Navigator)
18821565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18801407 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18797398 evidence of bipolar association was identified between haplotypes located in the 3'-region of TPH2 and BPI in the overall sample and in subgroups of familial cases, patient group with paternal transmission, and those with age of onset under 25 years
18797398 Observational study of gene-disease association. (HuGE Navigator)
18782386 TPH2 gene is associated with alcoholism among college students.
18496129 The polymorphisms rs10897346 and Pro312Pro in the TPH2 gene might play an important role for TPH2 expression and antidepressant drug response.
18496129 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18436425 Observational study of gene-disease association. (HuGE Navigator)
18427560 This study adds another piece of evidence to the notion that the investigated Tph2 Single Nucleotide Polymorphism are potentially functional, and that genetic variants affecting serotonergic neurotransmission may impact on prefrontal brain function.
18427560 Observational study of gene-disease association. (HuGE Navigator)
18405071 Observational study of gene-disease association. (HuGE Navigator)
18387780 Role of genes TPH2, 5-HTT, and MAOA regulating the serotonin metabolic pathway in the brain stain in the etiopathogenesis of the sudden infant death syndrome was studied.
18387780 Observational study of gene-disease association. (HuGE Navigator)
18347598 A loss-of-function mutation(r303W) in tryptophan hydroxylase 2 segregating with attention-deficit/hyperactivity disorder
18339632 Because this domain is unique to TPH2, these data provide evidence for selective regulation of brain serotonin synthesis
18314252 We found evidence for an additive effect of serotonin transporter and tryptophan hydroxylase-genotype in affective processing
18293859 the relation between the individual TPH alleles and the occurrences of suicidal tendencies have been presented.
18270970 Observational study of genotype prevalence. (HuGE Navigator)
18234415 TT genotype of tph2 carriers compensate deficits in executive control functions by increased brain activity
18234415 Observational study of gene-disease association. (HuGE Navigator)
18213624 Association between TPH2, perfomance on a continuous performance test and response to methylphenidate in ADHD participants is reported.
18213624 Observational study of gene-disease association. (HuGE Navigator)
18181017 Allele frequencies of three TPH2 variants and a TPH1 variant vary significantly among four ethnic groups with heroid adddiction.
18181017 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18180764 Single nucleotide polymorphisms were discovered through a systematic characterization of the genetic architecture of the TPH2 gene in major depression.
18180753 Depressed suicides have 26.5% more TPH2 grain density per neuron in the dorsal raphe nuclei compared with matched controls. This reflect a homeostatic response to deficient brain serotonin levels in these patients.
18163388 Observational study of gene-disease association. (HuGE Navigator)
17986837 Observational study of gene-disease association. (HuGE Navigator)
17986837 TPH2 703G/T SNP is related to nicotine dependence and is associated with the age of smoking onset.
17973628 purified TPH2 WT (wild-type) was activated by 30% after PKA phosphorylation and studies of the mutant enzymes showed that enzyme activation was mainly due to phosphorylation at Ser(19)
17972101 Both the 5'-UTR and common polymorphisms (especially the 90A/G) in the 5' regulatory region of human TPH2 have a significant impact on gene expression.
17905754 Observational study of gene-disease association. (HuGE Navigator)
17905754 SNPs located in a haplotype block covering the 5' region of the gene as well as a rare, non-synonymous SNP, resulting in a Pro206Ser substitution, showed significant association with bipolar disorder.
17892388 The results of this study underscore the role of the TPH2 G-703T polymorphism in the modulation of behavior and cognition.
17892388 Observational study of gene-disease association. (HuGE Navigator)
17768266 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17768266 This study supports the involvement of TPH2 in the etiology of BPD, and the functional single-nucleotide polymorphisms identified herein might be the susceptibility loci for BPD
17692928 Observational study of gene-disease association. (HuGE Navigator)
17649681 hopelessness, negative life-events and family history of suicide were risk factors of attempted suicide in major deprbssion while TPH2 gene rs7305115 A/A might be the protective factor.
17604842 No association was detected between the rs4131347 (-C8347G) SNP in the promoter region of the TPH2 gene and mood disorders, suicidal behavior or monoamine function.
17604842 Observational study of gene-disease association. (HuGE Navigator)
17592484 Results link TPH2 variations to pathogenesis of Tourette syndrome and support the relevance of serotonin signalling in Tourette's.
17568567 human TPH2 promoter polymorphism impacts on gene expression, which might have implications for the development and function of the serotonergic system in the brain
17539919 These data identify a region between the C-terminal oligomerization domain and the catalytic domain, which is indispensable for TPH2 activity.
17453063 Results reveal the presence of a functional cis-acting polymorphism, with high frequency in normal human subjects, resulting in increased TPH2 expression levels.
17413454 Polymorphism in this enzyme is not associated with schizophrenia in a Japanese population.
17408646 Observational study of gene-disease association. (HuGE Navigator)
17346350 Observational study of gene-disease association. (HuGE Navigator)
17346350 TPH2 gene variants are unlikely to contribute to autism or to the presence/absence of prominent repetitive behaviors in our sample, although an influence on the intensity of these behaviors in autism cannot be excluded
17335389 single-nucleotide polymorphism on the TPH2 gene explained more than 10% of the variance in both indicators of attention
17251907 Observational study of gene-disease association. (HuGE Navigator)
17251907 Haplotypes of the TPH2 gene are unlikely to play a major role in the pathophysiology of alcohol dependence or the alcoholism-related phenotype suicidal behavior.
17221847 Observational study of gene-disease association. (HuGE Navigator)
17221847 study reports the learning process of decision-making in suicide attempters to be modulated by four serotonergic gene polymorphisms, 5HTTLPR, TPH1 A218C, MAOA u-VNTR, and TPH2 rs1118997
17217922 Observational study of gene-disease association. (HuGE Navigator)
17192895 Absence of the Arg441His polymorphism in the tryptophan hydroxylase 2 gene in adults with anxiety disorders and depression.
17176492 Observational study of gene-disease association. (HuGE Navigator)
17176492 these findings implicate alterations of serotonin synthesis in emotion regulation and confirm TPH2 as a susceptibility and/or modifier gene of affective spectrum disorders
17176491 Observational study of gene-disease association. (HuGE Navigator)
17176491 A significant association between harm avoidance (HA), a trait related to anxiety, and tryptophan hydroxylase 2 polymorphism
17167340 Observational study of gene-disease association. (HuGE Navigator)
17167340 Case-control studies support the presence of a susceptibility locus for bipolar disorder in tryptophan hydroxylase 2.
17123728 Observational study of gene-disease association. (HuGE Navigator)
17123728 an association with rs1386494 SNP was observed in the subgroup of female patients with pure PD phenotype, indicating a possible gender-specific effect of TPH2 gene variants in panic disorder.
17123708 Observational study of gene-disease association. (HuGE Navigator)
17123708 A larger sample size will be required to clarify if TPH2 alleles are or are not associated with ADHD.
17015812 Observational study of gene-disease association. (HuGE Navigator)
17015812 Haplotype-based analysis of TPH2 in patients with UP and BP disorder provides preliminary evidence for protective association in both disorders and thus supports a central role for TPH2 in the pathogenesis of affective disorders.
17011525 Observational study of gene-disease association. (HuGE Navigator)
17011525 The A allele was significantly less frequent in patients with suicide behavior. Individuals with the A/A genotype showed a significantly lower risk of suicide behavior than those with the A/G or G/G genotype.
16958027 Observational study of gene-disease association. (HuGE Navigator)
16958027 It appears unlikely that the TPH1 and TPH2 genes play a significant role in the susceptibility to autism or to autism endophenotypes including severe obsessive-compulsive behaviors and self-stimulatory behaviors.
16936760 Variant is not a major determinant of genetic risk for depression in aged patients.
16894395 Observational study of gene-disease association. (HuGE Navigator)
16864580 the NH(2)-terminal regulatory domain is the source of hTPH2 instability and reduced solubility.
16806105 Observational study of gene-disease association. (HuGE Navigator)
16801378 Observational study of gene-disease association. (HuGE Navigator)
16759340 Observational study of gene-disease association. (HuGE Navigator)
16610957 Observational study of gene-disease association. (HuGE Navigator)
16610949 Observational study of gene-disease association. (HuGE Navigator)
16581035 Observational study of gene-disease association. (HuGE Navigator)
16581035 our results do not confirm the role of the R441H mutation of the hTPH2 gene in the susceptibility to unipolar major depression
16436194 Observational study of gene-disease association. (HuGE Navigator)
16436194 No association with history of suicide was found for the -473T > A and -8396G > C polymorphisms of the TPH2 gene in subjects with schizophrenia or bipolar disorder.
16401665 this first study of TPH2 in panic disorder argue against an importance of allelic variation of TPH2 in the pathogenesis of panic disorder
16395128 Observational study of gene-disease association. (HuGE Navigator)
16245070 Here, we used functional magnetic resonance imaging (fMRI) to demonstrate that a potentially functional variant of TPH2 modulates amygdala responsiveness to emotional stimuli of both negative and positive valence.
16116490 Observational study of gene-disease association. (HuGE Navigator)
16116490 Preferential transmissions were detected for the two SNPs in TPH2's regulatory region (rs4570625, rs11178997).
16044172 In vivo evidence that a relatively frequent regulatory variant (G(-844)T) of hTPH2 biases the reactivity of the amygdala, a neural structure critical in the generation and regulation of emotional behaviors.
15968084 TPH2 mRNA levels in postmortem parietal cortex of unipolar-depressed, bipolar, and schizophrenic patients vs control subjects, using real-time reverse transcription polymerase chain reaction. No significant difference in TPH2 mRNA levels was found.
15940290 Eight single nucleotide polymorphisms in the TPH2 gene for association with attention-deficit hyperactivity disorder in 179 Irish nuclear families.
15840421 Observational study of gene-disease association. (HuGE Navigator)
15768392 Observational study of gene-disease association. (HuGE Navigator)
15768392 TPH2 may play a modest role in autism susceptibility.
15629698 Identification of a loss-of-function mutation in hTPH2 suggests that defect in brain serotonin synthesis may represent an important risk factor for unipolar major depression.
15476687 Observational study of gene-disease association. (HuGE Navigator)
15476687 The findings of this study provide evidence for an involvement of genetic variants in the TPH2 gene in suicidal behavior.
15263906 Single nucleotide polymorphism data support existence of an affective disorder-associated haplotype in the THP2 gene.
15197398 It is unlikely that the hCV245410-hCV8376173-rs-1487280 haplotypes of TPH2 were involved in the suicidal behavior of 336 Canadian bipolar patients.
15167691 complex behavioral phenotypes or as actual risk factors. Structural polymorphisms are extremely rare in TPH2 and cannot therefore act as substantial risk factors for behavioral disorders in African-American and Caucasian populations.
15124006 Observational study of gene-disease association. (HuGE Navigator)
15124006 Single-nucleotide polymorphism (SNP), haplotype and linkage disequlibrium studies were performed on depressed patients and healthy controls with 10 SNPs in the TPH2 gene. Significant association was detected between one SNP and major depression.
15052272 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12511643 a second tryptophan hydroxylase isoform described

AA Sequence

MQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTLNKPNSGKNDDKGNKGSSKREAATESGKTAVVFSL      1 - 70
KNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCECGKTEFNELIQLLKFQTTIVTLNPPEN     71 - 140
IWTEEEELEDVPWFPRKISELDKCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRV    141 - 210
EYTEEETKTWGVVFRELSKLYPTHACREYLKNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAG    211 - 280
YLSPRDFLAGLAYRVFHCTQYIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDED    281 - 350
VQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYF    351 - 420
VSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLGI    421 - 490
//

Text Mined References (240)

PMID Year Title
26583347 2016 Effect of family structure and TPH2 G-703T on the stability of dysregulation profile throughout adolescence.
26497913 2015 Increased ethanol consumption despite taste aversion in mice with a human tryptophan hydroxylase 2 loss of function mutation.
26386440 2015 Interaction of tryptophan hydroxylase 2 gene and life events in susceptibility to major depression in a Chinese Han population.
26232682 2015 Genetic variability in tryptophan hydroxylase 2 gene in alcohol dependence and alcohol-related psychopathological symptoms.
26071405 2015 1,25-Dihydroxyvitamin D regulates expression of the tryptophan hydroxylase 2 and leptin genes: implication for behavioral influences of vitamin D.
26057341 2015 Tryptophan hydroxylase 2 gene is associated with cognition in late-onset depression in a Chinese Han population.
26028568 2015 Association analysis of TPH-1 and TPH-2 genes with suicidal behavior in patients with attempted suicide in Mexican population.
26013962 2015 Serotonin Transporter and Tryptophan Hydroxylase Gene Variations Mediate Working Memory Deficits of Cocaine Users.
26001668 2015 Serotonin gene polymorphisms and lifetime mood disorders in predicting interferon-induced depression in chronic hepatitis C.
25955598 2015 Methylation of the tryptophan hydroxylase?2 gene is associated with mRNA expression in patients with major depression with suicide attempts.
25455586 2015 Effect of tryptophan hydroxylase-2 gene polymorphism G-703 T on personality in a population representative sample.
25451452 2015 Association of COMT and TPH-2 genes with DSM-5 based PTSD symptoms.
25283578 2014 Association of TPH2 and dopamine receptor gene polymorphisms with obsessive-compulsive symptoms and perfectionism in healthy subjects.
25214390 2014 Interaction among childhood trauma and functional polymorphisms in the serotonin pathway moderate the risk of depressive disorders.
25152196 2015 Association study of TPH2 polymorphisms and bipolar disorder in the Han Chinese population.
25014617 2014 TPH2 genotype is associated with PTSD's avoidance symptoms in Chinese female earthquake survivors.
25005534 2014 Association of TPH-1 and TPH-2 gene polymorphisms with suicidal behavior: a systematic review and meta-analysis.
24958631 2014 Serotonin transporter gene: a new polymorphism may affect response to antidepressant treatments in major depressive disorder.
24942188 2014 Alcoholics have more tryptophan hydroxylase 2 mRNA and protein in the dorsal and median raphe nuclei.
24899127 2014 Functional characterization of the S41Y (C2755A) polymorphism of tryptophan hydroxylase 2.
24668623 2014 TPH2 gene polymorphisms in the regulatory region are associated with paranoid schizophrenia in Northern Han Chinese.
24491795 2014 Tryptophan hydroxylase 2 (TPH2) gene polymorphisms and psychiatric comorbidities in temporal lobe epilepsy.
24458851 2013 Tryptophan hydroxylase 2 gene polymorphisms in Japanese patients with medication overuse headaches.
24376086 2015 Lack of association between TPH2 gene polymorphisms with major depressive disorder in multiethnic Malaysian population.
24304270 2014 Regulatory variant of the TPH2 gene and early life stress are associated with heightened attention to social signals of fear in infants.
24260145 2013 Genetic polymorphisms in monoamine systems and outcome of cognitive behavior therapy for social anxiety disorder.
24196946 2014 Stimulation of 5-HT2C receptors improves cognitive deficits induced by human tryptophan hydroxylase 2 loss of function mutation.
24033289 2013 Estrogen receptor-? regulates human tryptophan hydroxylase-2 through an estrogen response element in the 5' untranslated region.
23995203 2013 Tryptophan hydroxylase 2 (TPH 2) single nucleotide polymorphisms, suicide, and alcohol-related suicide.
23992289 2013 Association of rs2129575 in the tryptophan hydroxylase 2 gene with clinical phenotypes of autism spectrum disorders.
23965265 2013 Synergistic effects of COMT and TPH2 on social cognition.
23716677 2013 Serotonin signaling in the brain of adult female mice is required for sexual preference.
23684859 2013 The tricks of the trait: neural implementation of personality varies with genotype-dependent serotonin levels.
23628433 2013 Genetic association and gene-gene interaction analyses suggest likely involvement of ITGB3 and TPH2 with autism spectrum disorder (ASD) in the Indian population.
23552096 2013 Associations between prefrontal ?-aminobutyric acid concentration and the tryptophan hydroxylase isoform 2 gene, a panic disorder risk allele in women.
23467366 2013 Cortical-amygdalar circuit dysfunction in a genetic mouse model of serotonin deficiency.
23461725 2013 Association between TPH2 gene polymorphisms and attention deficit hyperactivity disorder in Korean children.
23360517 2013 Involvement of tryptophan hydroxylase 2 gene polymorphisms in susceptibility to tic disorder in Chinese Han population.
23334703 2013 Brain-specific tryptophan hydroxylase, TPH2, and 5-HTTLPR are associated with frontal lobe symptoms in Alzheimer's disease.
23313272 2013 An association study of suicide and candidate genes in the serotonergic system.
23300701 2012 Genome-wide search for gene-gene interactions in colorectal cancer.
23258345 2014 Variation in key genes of serotonin and norepinephrine function predicts gamma-band activity during goal-directed attention.
23247084 2013 Family-based association study of tryptophan hydroxylase 2 and serotonin 1A receptor genes in attention deficit hyperactivity disorder.
23239044 2013 Genetic variation at the TPH2 gene influences impulsivity in addition to eating disorders.
23182718 2013 Autoantibodies against aromatic amino acid hydroxylases in patients with autoimmune polyendocrine syndrome type 1 target multiple antigenic determinants and reveal regulatory regions crucial for enzymatic activity.
23032942 2012 The association of attempted suicide with genetic variants in the SLC6A4 and TPH genes depends on the definition of suicidal behavior: a systematic review and meta-analysis.
22915309 2012 A common TPH2 haplotype regulates the neural processing of a cognitive control demand.
22868061 2012 The role of serotonergic genes and environmental stress on the development of depressive symptoms and neuroticism.
22835848 2013 Tryptophan hydroxylase 2 gene polymorphisms and poststroke anxiety disorders.
22721547 2012 Genetic variants in the tryptophan hydroxylase 2 gene (TPH2) and depression during and after pregnancy.
22698779 2012 Association with tryptophan hydroxylase 2 gene polymorphisms and autism spectrum disorders in Korean families.
22698518 2012 Melatonin pathway genes are associated with progressive subtypes and disability status in multiple sclerosis among Finnish patients.
22693556 2012 TPH2 gene polymorphisms and major depression--a meta-analysis.
22655589 2012 Investigation of tryptophan hydroxylase 2 (TPH2) in schizophrenia and in the response to antipsychotics.
22649797 2012 Impact of tryptophan hydroxylase 2 G-703T polymorphism on anger-related personality traits and orbitofrontal cortex.
22491354 2012 A functional Tph2 C1473G polymorphism causes an anxiety phenotype via compensatory changes in the serotonergic system.
22483952 2012 Association of TPH1, TPH2, and 5HTTLPR with PTSD and depressive symptoms.
22392150 2012 Common variants in the TPH2 promoter confer susceptibility to paranoid schizophrenia.
22365257 2012 Exploration of a possible association between the tryptophan hydroxylase 2 (TPH2) gene and panic symptoms induced by carbon dioxide in healthy individuals.
22361444 2012 A detailed association analysis between the tryptophan hydroxylase 2 (TPH2) gene and autism spectrum disorders in a Japanese population.
22342331 2012 A two-stage case-control association study between the tryptophan hydroxylase 2 (TPH2) gene and schizophrenia in a Japanese population.
22322887 2012 Emotion appraisal and the tryptophan hydroxylase 2 (TPH2) gene.
22072571 2011 Polymorphisms of stress-related genes and the risk of nonsyndromic cleft lip with or without cleft palate.
21969281 2011 Influence of birth weight on internalizing traits modulated by serotonergic genes.
21946031 2012 Hopelessness, a potential endophenotpye for suicidal behavior, is influenced by TPH2 gene variants.
21873838 2011 Association between tryptophan hydroxylase-2 gene and late-onset depression.
21829912 2011 Associations between polymorphic variants of the tryptophan hydroxylase 2 gene and obsessive-compulsive disorder.
21747395 2012 Tryptophan hydroxylase(2) gene polymorphisms predict brain serotonin synthesis in the orbitofrontal cortex in humans.
21621273 2011 Association of polymorphisms in HTR2A, HTR1A and TPH2 genes with suicide attempts in alcohol dependence: a preliminary report.
21620479 2011 Tryptophan hydroxylase 2 gene is associated with major depressive disorder in a female Chinese population.
21457069 2011 Association analysis of TPH2, 5-HT2A, and 5-HT6 with executive function in a young Chinese Han population.
21418063 2011 Serotonin and early cognitive development: variation in the tryptophan hydroxylase 2 gene is associated with visual attention in 7-month-old infants.
21418060 2011 TPH2 G/T polymorphism is associated with hyperphagia, IQ, and internalizing problems in Prader-Willi syndrome.
21396719 2011 Influence of TPH2 variants on diagnosis and response to treatment in patients with major depression, bipolar disorder and schizophrenia.
21257271 2011 Tryptophan hydroxylase-2 (TPH2) in disorders of cognitive control and emotion regulation: a perspective.
21198324 2010 Association between tryptophan hydroxylase 2 gene polymorphism and completed suicide.
21182896 2011 TPH2 polymorphisms and alcohol-related suicide.
21105877 2011 Tryptophan hydroxylase 2 aggregates through disulfide cross-linking upon oxidation: possible link to serotonin deficits and non-motor symptoms in Parkinson's disease.
21085052 2011 Association study of tryptophan hydroxylase 2 gene polymorphisms in bipolar disorder patients with panic disorder comorbidity.
21073637 2011 Associations of tryptophan hydroxylase gene polymorphisms with irritable bowel syndrome.
21049304 2011 Influence of candidate genes on attention problems in children: a longitudinal study.
20946355 2011 Association study in eating disorders: TPH2 associates with anorexia nervosa and self-induced vomiting.
20938755 2011 Association study of tryptophan hydroxylase-2 gene in schizophrenia and its clinical features in Chinese Han population.
20921119 2010 Attention-deficit/hyperactivity disorder symptoms in offspring of mothers with impaired serotonin production.
20869124 2011 Functional promoter polymorphism of the neuronal isoform of tryptophan hydroxylase (Tph2) in suicide.
20856248 2011 A functional alternative splicing mutation in human tryptophan hydroxylase-2.
20740293 2010 Genetic TPH2 variants and the susceptibility for migraine: association of a TPH2 haplotype with migraine without aura.
20738857 2010 Effect of tryptophan hydroxylase-2 rs7305115 SNP on suicide attempts risk in major depression.
20633049 2010 Anxiety and depression in children and adults: influence of serotonergic and neurotrophic genes?
20628266 2010 Association between tryptophan hydroxylase 2 polymorphism and anger-related personality traits among young Korean women.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20623453 2010 Linkage of schizophrenia with TPH2 and 5-HTR2A gene polymorphisms in the Malay population.
20515362 2010 Genetic predictors of response to treatment with citalopram in depression secondary to traumatic brain injury.
20470849 2010 A case-control association study of serotonin 1A receptor gene and tryptophan hydroxylase 2 gene in attention deficit hyperactivity disorder.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20451217 2010 Tryptophan-hydroxylase 2 haplotype association with borderline personality disorder and aggression in a sample of patients with personality disorders and healthy controls.
20446882 2010 Do candidate genes discriminate patients with an autism spectrum disorder from those with attention deficit/hyperactivity disorder and is there an effect of lifetime substance use disorders?
20403506 2010 Genetic variation in neuroendocrine genes associates with somatic symptoms in the general population: results from the EPIFUND study.
20396435 2010 Association between Serotonin-Related Polymorphisms in 5HT2A, TPH1, TPH2 Genes and Bipolar Disorder in Korean Population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20331984 2010 Effect of tryptophan hydroxylase-2 gene variants on amygdalar and hippocampal volumes.
20213726 2010 Common variants in the TPH1 and TPH2 regions are not associated with persistent ADHD in a combined sample of 1,636 adult cases and 1,923 controls from four European populations.
20144688 2010 Common genetic variations in TPH1/TPH2 genes are not associated with schizophrenia in Japanese population.
20126463 2010 Alternative splicing and extensive RNA editing of human TPH2 transcripts.
20124538 2010 Brainstem serotonergic deficiency in sudden infant death syndrome.
20064585 2010 Influence of functional tryptophan hydroxylase 2 gene variation and sex on the startle response in children, young adults, and older adults.
20052688 2010 Simultaneous analysis of serotonin transporter, tryptophan hydroxylase 1 and 2 gene expression in the ventral prefrontal cortex of suicide victims.
20043001 2010 Risk-taking behavior in a gambling task associated with variations in the tryptophan hydroxylase 2 gene: relevance to psychiatric disorders.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19894072 2010 A gene-environment investigation on personality traits in two independent clinical sets of adult patients with personality disorder and attention deficit/hyperactive disorder.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19829168 2009 Association study of serotonergic gene variants with antipsychotic-induced adverse reactions.
19816759 2009 Expression, purification and enzymatic characterization of the catalytic domains of human tryptophan hydroxylase isoforms.
19800079 2010 Association of polymorphisms of the tryptophan hydroxylase 2 gene with risk for bipolar disorder or suicidal behavior.
19781560 2010 Gender moderates the association between 5-HTTLPR and decision-making under ambiguity but not under risk.
19763617 2010 Involvement of tryptophan hydroxylase 2 (TPH2) gene polymorphisms in susceptibility to coronary artery lesions in Korean children with Kawasaki disease.
19748542 2009 TPH2 is not a susceptibility gene for suicide in Japanese population.
19742166 2009 Epistasis between IL1A, IL1B, TNF, HTR2A, 5-HTTLPR and TPH2 variations does not impact alcohol dependence disorder features.
19734157 Clinical and genetic risk factors for suicide under the influence of alcohol in a Polish sample.
19693267 2009 Financial and psychological risk attitudes associated with two single nucleotide polymorphisms in the nicotine receptor (CHRNA4) gene.
19679166 2009 TPH2 polymorphisms may modify clinical picture in treatment-resistant depression.
19674121 2009 Examination of tetrahydrobiopterin pathway genes in autism.
19590397 2009 5-HTR1A, 5-HTR2A, 5-HTR6, TPH1 and TPH2 polymorphisms and major depression.
19588223 2009 Population-specific functional variant of the TPH2 gene 2755C>A polymorphism contributes risk association to major depression and anxiety in Chinese peripartum women.
19548263 2010 A population-based association study of candidate genes for depression and sleep disturbance.
19506906 2009 Candidate gene studies of ADHD: a meta-analytic review.
19445671 2009 Genes within the serotonergic system are differentially expressed in human brain.
19434366 2009 Functional gene variants of the serotonin-synthesizing enzyme tryptophan hydroxylase 2 in migraine.
19365399 2009 Genetic predictors of response to antidepressants in the GENDEP project.
19361870 2009 TPH2 gene variants and anxiety during alcohol detoxification outcome.
19356604 2009 Variation in tryptophan hydroxylase-2 gene is not associated to male completed suicide in Estonian population.
19352219 2009 Support for tryptophan hydroxylase-2 as a susceptibility gene for bipolar affective disorder.
19352218 2009 Candidate gene analysis in an on-going genome-wide association study of attention-deficit hyperactivity disorder: suggestive association signals in ADRA1A.
19344641 2009 5'-Untranslated region of the tryptophan hydroxylase-2 gene harbors an asymmetric bidirectional promoter but not internal ribosome entry site in vitro.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19319927 2009 Functional properties of missense variants of human tryptophan hydroxylase 2.
19272410 2009 Tryptophan hydroxylase 2 gene is associated with major depression and antidepressant treatment response.
19233335 2009 Predominant expression of tryptophan hydroxylase 1 mRNA in the pituitary: a postmortem study in human brain.
19184136 2009 Examination of association of genes in the serotonin system to autism.
19181488 2009 Spatio-temporal expression of tryptophan hydroxylase isoforms in murine and human brain: convergent data from Tph2 knockout mice.
19175813 2009 The influence of family structure, the TPH2 G-703T and the 5-HTTLPR serotonergic genes upon affective problems in children aged 10-14 years.
19170664 2009 Association between Val66Met brain-derived neurotrophic factor (BDNF) gene polymorphism and post-treatment relapse in alcohol dependence.
19162119 2009 TPH2 -703G/T SNP may have important effect on susceptibility to suicidal behavior in major depression.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19132526 2009 A tryptophan hydroxylase 2 gene polymorphism is associated with panic disorder.
19125211 2009 Genotype over-diagnosis in amygdala responsiveness: affective processing in social anxiety disorder.
19125159 2010 Variations in tryptophan hydroxylase 2 linked to decreased serotonergic activity are associated with elevated risk for metabolic syndrome in depression.
19077664 2009 Resequencing of serotonin-related genes and association of tagging SNPs to citalopram response.
19071164 2009 TPH2 gene variation and conflict processing in a cognitive and an emotional Stroop task.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19052197 2008 A link between serotonin-related gene polymorphisms, amygdala activity, and placebo-induced relief from social anxiety.
19032968 2009 Serotonin genes and gene-gene interactions in borderline personality disorder in a matched case-control study.
19032713 2008 The tryptophan hydroxylase gene influences risk for bipolar disorder but not major depressive disorder: results of meta-analyses.
18937842 2008 The influence of serotonin- and other genes on impulsive behavioral aggression and cognitive impulsivity in children with attention-deficit/hyperactivity disorder (ADHD): Findings from a family-based association test (FBAT) analysis.
18832011 2008 Association testing of panic disorder candidate genes using CCK-4 challenge in healthy volunteers.
18826444 2008 Serotonergic genes and amygdala activity in response to negative affective facial stimuli in Korean women.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18801407 2008 P2RX7 Gln460Arg polymorphism is associated with depression among diabetic patients.
18797398 2008 Investigation of the tryptophan hydroxylase 2 gene in bipolar I disorder in the Romanian population.
18782386 2008 Tryptophan hydroxylase 2 gene and alcohol use among college students.
18496129 2008 Common genetic variations in human brain-specific tryptophan hydroxylase-2 and response to antidepressant treatment.
18436425 2008 The association between serotonin-related gene polymorphisms and panic disorder.
18427560 2009 Tph2 gene variants modulate response control processes in adult ADHD patients and healthy individuals.
18405071 2008 Alcohol dependence and polymorphisms of serotonin-related genes: association studies.
18387780 2008 Genes regulating the serotonin metabolic pathway in the brain stem and their role in the etiopathogenesis of the sudden infant death syndrome.
18347598 2008 A loss-of-function mutation in tryptophan hydroxylase 2 segregating with attention-deficit/hyperactivity disorder.
18339632 2008 A regulatory domain in the N terminus of tryptophan hydroxylase 2 controls enzyme expression.
18314252 2008 Additive effects of serotonin transporter and tryptophan hydroxylase-2 gene variation on neural correlates of affective processing.
18293859 2007 [Association between the TPH2 gene and suicidal behavior].
18270970 2008 Worldwide genetic variation in dopamine and serotonin pathway genes: implications for association studies.
18234415 2008 A functional variant of the tryptophan hydroxylase 2 gene impacts working memory: a genetic imaging study.
18213624 2008 Association between tryptophan hydroxylase 2, performance on a continuance performance test and response to methylphenidate in ADHD participants.
18181017 2008 TPH2 and TPH1: association of variants and interactions with heroin addiction.
18180764 2008 Genetic architecture of the human tryptophan hydroxylase 2 Gene: existence of neural isoforms and relevance for major depression.
18180753 2008 Elevated expression of tryptophan hydroxylase-2 mRNA at the neuronal level in the dorsal and median raphe nuclei of depressed suicides.
18163388 2008 Parent of origin effects in attention/deficit hyperactivity disorder (ADHD): analysis of data from the international multicenter ADHD genetics (IMAGE) program.
17986837 2007 The role of the TPH1 and TPH2 genes for nicotine dependence: a genetic association study in two different age cohorts.
17973628 2008 Activation and stabilization of human tryptophan hydroxylase 2 by phosphorylation and 14-3-3 binding.
17972101 2008 Functional characterization of the human TPH2 5' regulatory region: untranslated region and polymorphisms modulate gene expression in vitro.
17905754 2008 Brain-specific tryptophan hydroxylase 2 (TPH2): a functional Pro206Ser substitution and variation in the 5'-region are associated with bipolar affective disorder.
17892388 2007 Genetic variation of serotonin function and cognitive control.
17768266 2007 Association of functional polymorphisms of the human tryptophan hydroxylase 2 gene with risk for bipolar disorder in Han Chinese.
17692928 2008 The tryptophan hydroxylase (TPH) 2 gene unlike TPH-1 exhibits no association with stress-induced depression.
17649681 2007 [A case-control study on the risk factors for attempted suicide in patients with major depression].
17604842 2008 No association between a TPH2 promoter polymorphism and mood disorders or monoamine turnover.
17592484 2007 Role of the novel tryptophan hydroxylase-2 gene in Tourette syndrome.
17568567 2007 Characterization of a functional promoter polymorphism of the human tryptophan hydroxylase 2 gene in serotonergic raphe neurons.
17539919 2007 Influence of human tryptophan hydroxylase 2 N- and C-terminus on enzymatic activity and oligomerization.
17453063 2007 Tryptophan hydroxylase 2 (TPH2) haplotypes predict levels of TPH2 mRNA expression in human pons.
17413454 2007 No genetic association between tryptophan hydroxylase 2 gene polymorphisms and Japanese schizophrenia.
17408646 2007 Serotonin-1A receptor gene HTR1A variation predicts interferon-induced depression in chronic hepatitis C.
17346350 2007 Case-control and family-based association studies of candidate genes in autistic disorder and its endophenotypes: TPH2 and GLO1.
17335389 2007 Impaired executive control is associated with a variation in the promoter region of the tryptophan hydroxylase 2 gene.
17251907 2007 SNP- and haplotype analysis of the tryptophan hydroxylase 2 gene in alcohol-dependent patients and alcohol-related suicide.
17221847 2007 The influence of four serotonin-related genes on decision-making in suicide attempters.
17217922 2007 Effect of tryptophan hydroxylase-2 gene variants on suicide risk in major depression.
17192895 2007 Absence of the Arg441His polymorphism in the tryptophan hydroxylase 2 gene in adults with anxiety disorders and depression.
17176492 2007 Tryptophan hydroxylase-2 gene variation influences personality traits and disorders related to emotional dysregulation.
17176491 2007 Association between a polymorphism in the promoter region of the TPH2 gene and the personality trait of harm avoidance.
17167340 2007 Polymorphisms in the neuronal isoform of tryptophan hydroxylase 2 are associated with bipolar disorder in French Canadian pedigrees.
17123728 2007 Association study of tryptophan hydroxylase 2 gene polymorphisms in panic disorder.
17123708 2007 No association between TPH2 gene polymorphisms and ADHD in a UK sample.
17015812 2006 Association of brain-specific tryptophan hydroxylase, TPH2, with unipolar and bipolar disorder in a Northern Swedish, isolated population.
17011525 2006 Effect of SNP at position 40237 in exon 7 of the TPH2 gene on susceptibility to suicide.
16958027 2006 Family-based association study of TPH1 and TPH2 polymorphisms in autism.
16936760 2006 Genotyping of the G1463A (Arg441His) TPH2 polymorphism in a geriatric population of patients with major depression.
16894395 2006 The analysis of 51 genes in DSM-IV combined type attention deficit hyperactivity disorder: association signals in DRD4, DAT1 and 16 other genes.
16864580 2006 Functional domains of human tryptophan hydroxylase 2 (hTPH2).
16806105 2007 Nested association between genetic variation in tryptophan hydroxylase II, bipolar affective disorder, and suicide attempts.
16801378 2007 Additive effects of serotonin transporter and tryptophan hydroxylase-2 gene variation on emotional processing.
16759340 2006 Analysis of variations in the tryptophan hydroxylase-2 (TPH2) gene in cocaine dependence.
16610957 2006 Combinations of single nucleotide polymorphisms in neuroendocrine effector and receptor genes predict chronic fatigue syndrome.
16610949 2006 Polymorphisms in genes regulating the HPA axis associated with empirically delineated classes of unexplained chronic fatigue.
16581035 2006 No human tryptophan hydroxylase-2 gene R441H mutation in a large cohort of psychiatric patients and control subjects.
16541075 2006 The finished DNA sequence of human chromosome 12.
16436194 2006 The interaction between TPH2 promoter haplotypes and clinical-demographic risk factors in suicide victims with major psychoses.
16401665 2006 The novel brain-specific tryptophan hydroxylase-2 gene in panic disorder.
16395128 2006 Possible association between response inhibition and a variant in the brain-expressed tryptophan hydroxylase-2 gene.
16245070 2005 Amygdala responsiveness is modulated by tryptophan hydroxylase-2 gene variation.
16116490 2005 Transmission disequilibrium of polymorphic variants in the tryptophan hydroxylase-2 gene in attention-deficit/hyperactivity disorder.
16044172 2005 A regulatory variant of the human tryptophan hydroxylase-2 gene biases amygdala reactivity.
16027738 2005 Lack of association of TPH2 exon XI polymorphisms with major depression and treatment resistance.
15968084 2005 Postmortem parietal cortex TPH2 expression is not altered in schizophrenic, unipolar-depressed, and bipolar patients vs control subjects.
15940290 2005 Tryptophan hydroxylase 2 (TPH2) gene variants associated with ADHD.
15840421 2005 Promoter polymorphism of second tryptophan hydroxylase isoform (TPH2) in schizophrenia and suicidality.
15768392 2005 Possible association between autism and variants in the brain-expressed tryptophan hydroxylase gene (TPH2).
15629698 2005 Loss-of-function mutation in tryptophan hydroxylase-2 identified in unipolar major depression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476687 2004 Single nucleotide polymorphism and haplotype analysis of a novel tryptophan hydroxylase isoform (TPH2) gene in suicide victims.
15263906 2004 Support for the involvement of TPH2 gene in affective disorders.
15247473 2004 Tryptophan hydroxylase-2 controls brain serotonin synthesis.
15197398 2004 Analysis of the novel TPH2 gene in bipolar disorder and suicidality.
15167691 2004 Identification of genetic variants in the neuronal form of tryptophan hydroxylase (TPH2).
15124006 2004 SNP and haplotype analysis of a novel tryptophan hydroxylase isoform (TPH2) gene provide evidence for association with major depression.
15052272 2004 Investigation of serotonin-related genes in antidepressant response.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14563478 2003 A unique central tryptophan hydroxylase isoform.
12511643 2003 Synthesis of serotonin by a second tryptophan hydroxylase isoform.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.