Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.700 4.1e-03
atypical teratoid / rhabdoid tumor -1.200 3.0e-03
ependymoma -2.100 3.0e-02
glioblastoma -1.300 6.5e-03
group 4 medulloblastoma 1.200 6.4e-06
lung adenocarcinoma -1.157 5.3e-05
lung cancer 2.600 2.4e-03
malignant mesothelioma -1.100 1.6e-05
medulloblastoma, large-cell -2.100 3.5e-04
non primary Sjogren syndrome sicca 1.100 1.9e-02
oligodendroglioma -2.300 1.2e-02
osteosarcoma -1.106 3.3e-02
ovarian cancer 1.200 3.6e-03
primitive neuroectodermal tumor 1.300 1.9e-04

 GWAS Trait (1)

Protein-protein Interaction (4)

AA Sequence

MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCVMPEDVKNFYL      1 - 70
MTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDS     71 - 140
RSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFT    141 - 210
SYGISPQAKQWFSMYKPITYNTNLLTEETDSFVNKLDPSKVFKSKNKIVIPKKKGPVQPAGGQKGPSGPS    211 - 280
GPSTSSTSKSSSGSGNPTRK                                                      281 - 300
//

Text Mined References (11)

PMID Year Title