Property Summary

Ligand Count 2
NCBI Gene PubMed Count 32
PubMed Score 46.03
PubTator Score 33.50

Knowledge Summary

Patent (2,158)

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.500 4.3e-03
medulloblastoma, large-cell 1.100 3.8e-03
osteosarcoma -1.578 1.8e-05
ovarian cancer 1.200 1.2e-05

Gene RIF (19)

AA Sequence

MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYRSINHRVDASS      1 - 70
MWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTESVEVLCLLVFAADL     71 - 140
SVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIR    141 - 210
WSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIP    211 - 280
AYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGA    281 - 350
FPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSP    351 - 420
FLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFA    421 - 490
LGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSLWDMTRMLNMLIVFRFLRIIP    491 - 560
SMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLE    561 - 630
YWANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHK    631 - 700
WDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERLSQHPHLWLCR                      701 - 752
//

Text Mined References (33)

PMID Year Title