Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 2.000 8.3e-06
astrocytic glioma -1.300 1.3e-02
psoriasis -2.000 1.0e-04
osteosarcoma -1.637 2.4e-06
group 3 medulloblastoma 1.700 2.9e-04
colon cancer -1.300 9.1e-03
active Crohn's disease 1.164 1.7e-02
ovarian cancer -1.600 1.8e-09

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (4)

PMID Text
26410378 KIAA0495 methylation was detected in none of both primary myeloma samples at diagnosis (N = 61) and at relapse/progression (N = 16). KIAA0495 methylation appeared unimportant in the pathogenesis or progression of myeloma.
22388545 Report expression of TP73 isoforms in human cell lines.
20477830 The study suggested that PDAM might function as a non-protein-coding RNA.And PDAM deregulation play a role in oligodendroglial tumors development, PDAM may possess the capacity to modulate apoptosis via regulation of p53-dependent anti-apoptotic genes.
20477830 PDAM knockdown induces cisplatin resistance in glioma cells harboring wild-type p53. The finding suggests that PDAM may possess the capacity to modulate apoptosis via regulation of p53-dependent anti-apoptotic genes (BCL2 and BCL2L1).

AA Sequence

MCLLSSSAASDLAATSLTAHPCHPPLPRQPQPQLILSGSPSIGTVPPPAVGHTSLLPVNPPAISTTTSDL      1 - 70
SAREDATPSASTGHLSVFPAFQVKIPAVPSEQTSQSFSEASHRVLPGGGPRCSRDFGAGVAGHLGLGIFG     71 - 140
VGFGSPALLQSVVDENSCCLLYVVEDQLCDVEQAFRAEHLGQHQSGSGTGCRHCPQRPAAL             141 - 201
//

Text Mined References (8)

PMID Year Title
26410378 2015 Epigenetic silencing of a long non-coding RNA KIAA0495 in multiple myeloma.
23726844 2013 A long non-coding RNA signature in glioblastoma multiforme predicts survival.
22388545 2012 Relative expression of TAp73 and ?Np73 isoforms.
20477830 2010 KIAA0495/PDAM is frequently downregulated in oligodendroglial tumors and its knockdown by siRNA induces cisplatin resistance in glioma cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.