Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.80
PubTator Score 7.67

Knowledge Summary

Patent (3,312)

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.698 1.2e-06
glioblastoma 1.300 3.7e-06
group 4 medulloblastoma 1.500 7.4e-06
atypical teratoid / rhabdoid tumor 1.100 1.4e-03
medulloblastoma, large-cell 1.700 6.0e-06
pediatric high grade glioma 1.200 5.5e-07
breast carcinoma 1.100 1.2e-14
ductal carcinoma in situ 1.100 2.9e-04
invasive ductal carcinoma 1.400 2.8e-03
ovarian cancer 1.100 1.3e-04

Gene RIF (4)

PMID Text
24351856 In a study addressing genetic, social, and environmental contributors of chronic kidney disease with tubulointerstitial damages in Sri Lanka, TP53RK was not confirmed to be genetically significant.
20677014 Observational study of gene-disease association. (HuGE Navigator)
17712528 activation of PRPK is mediated by another kinase, Akt/PKB, which phosphorylates PRPK at Ser250
16600182 A Small Ras-like GTPase protein Ray was indicated to modulate p53 transcriptional activity of PRPK.

AA Sequence

MAAARATTPADGEEPAPEAEALAAARERSSRFLSGLELVKQGAEARVFRGRFQGRAAVIKHRFPKGYRHP      1 - 70
ALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLS     71 - 140
NLAKTIGQVLARMHDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLST    141 - 210
HPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG                               211 - 253
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24351856 2014 An integrative study of the genetic, social and environmental determinants of chronic kidney disease characterized by tubulointerstitial damages in the North Central Region of Sri Lanka.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22912744 2012 The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17712528 2007 Phosphorylation and activation of the atypical kinase p53-related protein kinase (PRPK) by Akt/PKB.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16600182 2006 A Small Ras-like protein Ray/Rab1c modulates the p53-regulating activity of PRPK.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12914926 2003 Functional homology between yeast piD261/Bud32 and human PRPK: both phosphorylate p53 and PRPK partially complements piD261/Bud32 deficiency.
12659830 2003 Identification of CGI-121, a novel PRPK (p53-related protein kinase)-binding protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11546806 2001 Cloning and characterization of a p53-related protein kinase expressed in interleukin-2-activated cytotoxic T-cells, epithelial tumor cell lines, and the testes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.