Property Summary

NCBI Gene PubMed Count 39
PubMed Score 218.23
PubTator Score 90.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (32)

PMID Text
26813458 miR-205/TP53INP1 mediated autophagy pathway might be an important molecular mechanism regulating radiosensitivity of prostate cancer cells
26512655 silencing of TP53inp1 leads radiation induced autophagy impairment and induces accumulation of damaged mitochondria in primary human fibroblasts.
26367773 FOXP1, TP53INP1, TNFAIP3, and TUSC2 were identified as miR-19a targets.
26252115 MicroRNA205 promotes the tumorigenesis of nasopharyngeal carcinoma through targeting TP53INP1 protein.
25633840 TGFB1 induced miR-155 regulates TP53INP1 expression, epithelial-mesenchymal transition and acquisition of a stem cell phenotype.
25601564 miR-155 may play an important role in promoting the generation of stem cell-like cells and their self-renewal by targeting the gene TP53INP1.
25490449 Results demonstrate that miR-569 is overexpressed in a subset of ovarian and breast cancers and alters cell survival and proliferation through downregulation of TP53INP1 expression.
24922517 GWAS identifies TP53INP1 as new susceptibility gene for Alzheimer's disease.
24608790 TP53INP1 SUMOylation is essential for the regulation of p53 activity induced by oxidative stress.
24551280 Study reveals that miR-155 acts as an oncogene by targeting TP53INP1 in esophageal squamous cell carcinoma.
24447717 miR-182/TP53INP1 signaling represents a novel pathway regulating chemoresistance in cisplatin-treated hepatocellular carcinoma
24152184 Expression of miR-155 is significantly higher in MCF-7 cells compared with MDA-MB-231 cells. Ectopic expression of TP53INP1 inhibits growth of MCF-7 cells by inducing cell apoptosis and inhibiting cell cycle progression.
23568502 Upregulation of miR-155, mediated by estradiol, and consequent downregulation of TP53INP1 potentially promotes breast cancer development and progression.
23333058 Fndings indicate that miR-17-5p/20a promote gastric cancer cell proliferation and inhibit cell apoptosis via post-transcriptional modulation of p21 and TP53INP1.
22730212 miR-17-5p functions as a tumor suppressor in cervical cancer cells by targeting tumor protein p53-induced nuclear protein 1.
22470510 TP53INP1 identified two conserved regions in the DOR family that concentrate multiple functions crucial for autophagy and transcription.
22421968 cell death observed after TP53INP1-LC3 interaction depends on both autophagy and caspase activity.
22213058 TP53INP1 antisense oligonucleotide inhibits proliferation and induces apoptosis in castration-sensitive LNCaP tumor cells.
21538421 In normal prostate tissues, TP53INP1 is only expressed in prostate basal cells. There is a de novo TP53INP1 expression in prostate luminal cells in inflammatory prostate tissues, high grade PIN lesions and in prostate cancer.
21339733 This novel TP53INP1 activity on the regulation of SPARC expression could explain in part its tumor suppressor function in pancreatic adenocarcinoma by modulating cellular spreading during the metastatic process
21219856 TP53INP1 is a tumor suppressor in esophageal squamous cell carcinoma (ESCC0; c-Myc-mediated DNA methylation-associated silencing of TP53INP1 contributed to the pathogenesis of human ESCC.
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18974142 findings implicate a miR-93/miR-130b-TP53INP1 axis that affects the proliferation and survival of HTLV-1-infected/transformed cells
18277909 P53DINP1 mRNA expression promotes Ser46 phophlrylation of p53, without finding a significant correlation between mRNA expression of p53AIP1.
18277906 The p53DINP1 mRna expression in the antral mucosa was significantly lower in the gastric cancer patients than in the chronic gastritis patients.
17537403 PLZF upregulates apoptosis-inducer TP53INP1, ID1, and ID3 genes, and downregulates the apoptosis-inhibitor TERT gene
17393983 TP531NP1 plays a significant role in the progression of anaplastic carcinoma or contributes to anaplastic transformation from papillary or follicular carcinoma, which is in sharp contrast to findings in previous in vitro and in vivo studies.
16521180 TP53INP1 protein negativity is significantly associated with aggressive pathological phenotypes of gastric cancer.
16044147 TP53INP1s are functionally associated with p73 to regulate cell cycle progression and apoptosis.
12851404 TP53INP1s and HIPK2 could be partners in regulating p53 activity.
12438758 Assignment of tumor protein p53 induced nuclear protein 1 (TP53INP1) gene to human chromosome band 8q22 by in situ hybridization.
12067065 Data show that induction of the stress-induced proteins (SIPs) SIP18 and SIP27, in human- and mouse-derived cell lines, is absent from cells with deleted, mutated or inactive p53, suggesting that regulation of SIP gene expression is dependent on p53.

AA Sequence

MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLP      1 - 70
ASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPG     71 - 140
LSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLR    141 - 210
RQNLTRDCHPRQVKHNGWVVHQPCPRQYNY                                            211 - 240
//

Text Mined References (40)

PMID Year Title
26813458 2016 MiR-205 suppresses autophagy and enhances radiosensitivity of prostate cancer cells by targeting TP53INP1.
26512655 2015 TP53inp1 Gene Is Implicated in Early Radiation Response in Human Fibroblast Cells.
26367773 2015 Uncovering Direct Targets of MiR-19a Involved in Lung Cancer Progression.
26252115 2015 MicroRNA?205 promotes the tumorigenesis of nasopharyngeal carcinoma through targeting tumor protein p53-inducible nuclear protein 1.
25633840 2015 TGF-?1 acts through miR-155 to down-regulate TP53INP1 in promoting epithelial-mesenchymal transition and cancer stem cell phenotypes.
25601564 2015 MiR-155 targets TP53INP1 to regulate liver cancer stem cell acquisition and self-renewal.
25490449 2014 Copy number gain of hsa-miR-569 at 3q26.2 leads to loss of TP53INP1 and aggressiveness of epithelial cancers.
24922517 2014 Gene-wide analysis detects two new susceptibility genes for Alzheimer's disease.
24608790 2014 Oxidative stress-induced p53 activity is enhanced by a redox-sensitive TP53INP1 SUMOylation.
24551280 2014 microRNA-155 acts as an oncogene by targeting the tumor protein 53-induced nuclear protein 1 in esophageal squamous cell carcinoma.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24447717 2014 Upregulated miR-182 increases drug resistance in cisplatin-treated HCC cell by regulating TP53INP1.
24152184 2013 MiR-155 promotes proliferation of human breast cancer MCF-7 cells through targeting tumor protein 53-induced nuclear protein 1.
23568502 2013 17?-estradiol up-regulates miR-155 expression and reduces TP53INP1 expression in MCF-7 breast cancer cells.
23333058 2013 miR-17-5p/20a are important markers for gastric cancer and murine double minute 2 participates in their functional regulation.
22730212 2012 MiR-17-5p targets TP53INP1 and regulates cell proliferation and apoptosis of cervical cancer cells.
22470510 2012 DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription.
22421968 2012 TP53INP1, a tumor suppressor, interacts with LC3 and ATG8-family proteins through the LC3-interacting region (LIR) and promotes autophagy-dependent cell death.
22213058 2012 TP53INP1 as new therapeutic target in castration-resistant prostate cancer.
21538421 2012 TP53INP1 overexpression in prostate cancer correlates with poor prognostic factors and is predictive of biological cancer relapse.
21339733 2011 TP53INP1 decreases pancreatic cancer cell migration by regulating SPARC expression.
21219856 2011 c-Myc inhibits TP53INP1 expression via promoter methylation in esophageal carcinoma.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
18974142 2008 Roles for microRNAs, miR-93 and miR-130b, and tumor protein 53-induced nuclear protein 1 tumor suppressor in cell growth dysregulation by human T-cell lymphotrophic virus 1.
18277909 2008 Insights in gastric carcinogenesis from Helicobacter pylori infection.
18277906 2008 Difference of p53AIP1 mRNA expression in gastric mucosa between patients with gastric cancer and chronic gastritis infected with Helicobacter pylori.
17537403 2007 Identification of apoptosis-related PLZF target genes.
17393983 2006 High level of tumour protein p53-induced nuclear protein 1 (TP53INP1) expression in anaplastic carcinoma of the thyroid.
16521180 2006 Down-expression of tumor protein p53-induced nuclear protein 1 in human gastric cancer.
16377624 2006 Protein kinase C delta regulates Ser46 phosphorylation of p53 tumor suppressor in the apoptotic response to DNA damage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16044147 2005 TP53INP1 is a novel p73 target gene that induces cell cycle arrest and cell death by modulating p73 transcriptional activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12851404 2003 TP53INP1s and homeodomain-interacting protein kinase-2 (HIPK2) are partners in regulating p53 activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438758 2002 Assignment of tumor protein p53 induced nuclear protein 1 (TP53INP1) gene to human chromosome band 8q22 by in situ hybridization.
12067065 2002 P53-dependent expression of the stress-induced protein (SIP).
11511362 2001 p53DINP1, a p53-inducible gene, regulates p53-dependent apoptosis.