Property Summary

NCBI Gene PubMed Count 85
PubMed Score 68.43
PubTator Score 72.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.317 2.7e-11
group 4 medulloblastoma 1.200 9.1e-04
acute myeloid leukemia 2.400 1.4e-02
ovarian cancer 1.200 3.1e-03
Down syndrome 1.100 1.7e-02

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (49)

PMID Text
26663100 miR-548d-3p/TP53BP2 pathway is critically involved in the proliferation and apoptosis of breast cancer cells and may be new therapeutic target of breast cancer cells.
26595804 ASPP1/2-PP1 complexes are required for chromosome segregation and kinetochore-microtubule attachments.
26438046 ASSP2 expression is lower in cancerous tissues and decreased ASPP2 lead to higher cancer cells proliferation and autophagic flux, which contribute to the gemcitabine resistance.
25963096 These results identify previously uncharacterized regions distributed throughout the protein sequence of ASPP2 as determinants of CagA binding, providing mechanistic insight into apoptosis reprogramming by CagA.
25660448 ASPP1/2 interacted with centrosome linker protein C-Nap1. Co-depletion of ASPP1 and ASPP2 inhibited re-association of C-Nap1 with centrosome at the end of mitosis.
25534115 this study revealed a novel function of ASPP2 in modulating autophagy and apoptosis.
25436413 these observations reveal that Itch and Yap1 have antagonistic roles in the regulation of ASPP2 protein stability through competing post-translational regulatory mechanism of ASPP2.
25360797 ASPP2 directly induces the dephosphorylation and activation of junctional YAP
25344754 ASPP2 prevents beta-catenin from transactivating ZEB1 directly by forming an ASPP2-beta-catenin-E-cadherin ternary complex
25256142 ASPP2 may participate in the lipid metabolism of non-alcoholic steatohepatitis and attenuate liver failure.
25032846 CHOP is critical for mediating ASPP2-induced autophagic apoptosis by decreasing Bcl-2 expression and maintaining nuclear ASPP2-Bcl-2 complexes.
24474782 Disruption of CagA and ASPP2 binding alters the function of ASPP2 and leads to the decreased survival of H. pylori-infected cells
24312625 phosphorylation of ASPP2 by RAS/MAPK pathway provides a novel link between RAS and p53 in regulating apoptosis
24312201 Attenuated expression of apoptosis stimulating protein of p53-2 (ASPP2) in human acute leukemia is associated with therapy failure.
23671128 We also unveiled a possible mechanistic link between ASPP2 and Csk/Src signaling pathway, implicating the multiple cellular functions of ASPP2.
23644657 our studies demonstrate the role of Siah2 in regulation of tight junction integrity and cell polarity under hypoxia, through its regulation of ASPP2 stability.
23606740 FIH-1 depletion did lead to impaired binding of Par-3 to ASPP2.
23528480 higher rate Helicobacter pylori infection, an increased expression of inhibitor of apoptosis stimulating protein of p53 (iASPP), and decreased expression of apoptosis-stimulating of p53 protein 2(ASPP2) was present in gastric cancer
23472201 the intramolecular interaction in ASPP2 regulates its binding to p53CD and ASPP2 Ank-SH3 binds Bcl-2 and NFkappaB via distinct sites
23392125 ASPP1 and ASPP2 cooperate with RAS to enhance p53-induced apoptosis suggests that loss of ASPP1 or ASPP2 expression may be a frequent event in human cancers with mutant RAS.
23248303 ASPP2 binds to Ras-GTP at the plasma membrane and stimulates Ras-induced signaling and pERK1/2 levels via promoting Ras-GTP loading, B-Raf/C-Raf dimerization, and C-Raf phosphorylation.
23088536 When the Px(T)PxR motif is deleted or mutated via insertion of a phosphorylation site mimic (T311D), PP-1c fails to bind to all three ASPP proteins, ASPP1, ASPP2 and iASPP.
22552744 the mRNA expression of ASPP1 and ASPP2 was frequently dowregulated in tumor tissues, and this decreased significantly in samples expressing wild-type p53
22169642 Methylation in the promoter region of ASPP2 gene was not detected in lung cancer or adjacent non-neoplastic lung tissue.
21562218 Helicobacter pylori cytotoxin-associated gene A (CagA) subverts the apoptosis-stimulating protein of p53 (ASPP2) tumor suppressor pathway of the host
21189257 PP1A and ASPP2 play a critical role in promoting TAZ function by antagonizing the LATS kinase through TAZ dephosphorylation.
21183427 study was to determine localization pattern of ASPP-2 in a variety of normal and malignant human tissues; study indicates that ASPP-2 has a specific distribution pattern within tissues and cells in a way that appears to be related to differentiation
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20034025 ASPP1 and ASPP2 genes are frequently down-regulated by DNA methylation in HBV-positive hepatocellular carcinoma, which may play important roles in the development of HCC
19539330 bcl2 -938C/C genotype has worse prognosis and lower survival in patients with renal cell carcinoma. In addition, the bcl2 -938C/A single nucleotide polymorphism was shown to be an independent adverse prognostic factor for renal cell carcinoma
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19507243 ASPP2(ANK-SH3) binds NFkappaB(p65) in a similar manner to its natural inhibitor IkappaB, suggesting a possible novel role for ASPP2 as an NFkappaB inhibitor
19246451 ASPP2 primarily binds to the core domain of p53, whereas iASPP predominantly interacts with a linker region adjacent to the core domain.
18793611 Together these results identify ASPP2 as a bona fide DDA3 interacting protein, and suggest that the ASPP2/DDA3 interaction may inhibit ASPP2 in stimulating the apoptotic signaling of p53.
18719108 identifies the interaction sites of Bcl-2 and its homologues with ASPP2
17965023 53BP2S interacts and modulates the insulin signals mediated by insulin receptor substrates.
17594908 suggest a possible role for the N-termini of ASPP proteins in binding to other proteins in the apoptotic response network
16139958 role of ASPP1, ASPP2, and iASPP as apoptotic specific regulators of p53 [review]
16098144 In this study we explored the effect of NF-kappaB activation elicited by a physiological NF-kappaB inducer, interleukin-1beta (IL-1beta), and anti-apoptotic Bcl-2 family proteins on the 53BP2S-mediated apoptosis
16091363 ASPP2/(53BP2L) expression regulation by proteasomal degradation modulates p53 apoptotic function
15986435 Observational study of gene-disease association. (HuGE Navigator)
15986435 results suggest that the tumor protein p53 binding protein(TP53BP2) locus is associated with susceptibility to gastric cancer in the Korean population
15782125 Mdm2 and mdmx prevent ASPP1 and ASPP2 from stimulating the apoptotic function of p53 by binding and inhibiting the transcriptional activity of p53.
15757645 ASPP2 CpG island aberrant methylation could be one molecular and genetic alteration in wild-type p53 tumours.
15731768 target of E2F transcription factor
15592436 downstream of E2F, suggesting that it functions as a common link between the p53/p73 and Rb/E2F apoptotic pathways
14766226 TP53BP2 encodes two mRNA species, either with (53BP2) or without exon 3 (ASPP2), by alternative splicing in various cell lines and tissues
12694406 ASPP2 is a negative regulator of the neddylation pathway through specific interaction with APP-BP1 and suggest that dysfunction of the APP-BP1 interaction with APP may be one cause of Alzheimer's disease

AA Sequence

MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFG      1 - 70
SQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQ     71 - 140
QIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKL    141 - 210
VEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQ    211 - 280
NAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPY    281 - 350
IQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADL    351 - 420
FPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQV    421 - 490
ANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIP    491 - 560
SVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSA    561 - 630
LTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPT    631 - 700
KLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSY    701 - 770
PSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDN    771 - 840
SPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRK    841 - 910
TGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQ    911 - 980
FGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGV    981 - 1050
QEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRI   1051 - 1120
KPRQRSLA                                                                 1121 - 1128
//

Text Mined References (95)

PMID Year Title
26663100 2016 miR-548d-3p/TP53BP2 axis regulates the proliferation and apoptosis of breast cancer cells.
26595804 2015 ASPP1/2-PP1 complexes are required for chromosome segregation and kinetochore-microtubule attachments.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26438046 2015 Downregulation of ASPP2 in pancreatic cancer cells contributes to increased resistance to gemcitabine through autophagy activation.
25963096 2015 An Intrinsically Disordered Region in the Proapoptotic ASPP2 Protein Binds to the Helicobacter pylori Oncoprotein CagA.
25660448 2015 The tumor suppressor proteins ASPP1 and ASPP2 interact with C-Nap1 and regulate centrosome linker reassembly.
25547411 2014 Identifying tandem Ankyrin repeats in protein structures.
25534115 2015 ASPP2 enhances oxaliplatin (L-OHP)-induced colorectal cancer cell apoptosis in a p53-independent manner by inhibiting cell autophagy.
25436413 2015 The E3 ubiquitin ligase Itch and Yap1 have antagonistic roles in the regulation of ASPP2 protein stability.
25416956 2014 A proteome-scale map of the human interactome network.
25360797 2014 ASPP2 links the apical lateral polarity complex to the regulation of YAP activity in epithelial cells.
25344754 2014 ASPP2 controls epithelial plasticity and inhibits metastasis through ?-catenin-dependent regulation of ZEB1.
25256142 2015 ASPP2 attenuates triglycerides to protect against hepatocyte injury by reducing autophagy in a cell and mouse model of non-alcoholic fatty liver disease.
25032846 2014 CHOP mediates ASPP2-induced autophagic apoptosis in hepatoma cells by releasing Beclin-1 from Bcl-2 and inducing nuclear translocation of Bcl-2.
24855949 2014 A code for RanGDP binding in ankyrin repeats defines a nuclear import pathway.
24474782 2014 Structure of the Helicobacter pylori CagA oncoprotein bound to the human tumor suppressor ASPP2.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24312625 2013 Phosphorylation of ASPP2 by RAS/MAPK pathway is critical for its full pro-apoptotic function.
24312201 2013 Attenuated expression of apoptosis stimulating protein of p53-2 (ASPP2) in human acute leukemia is associated with therapy failure.
23671128 2013 Downregulation of ASPP2 in choriocarcinoma contributes to increased migratory potential through Src signaling pathway activation.
23644657 2014 Siah2 regulates tight junction integrity and cell polarity through control of ASPP2 stability.
23606740 2013 Factor inhibiting HIF-1 (FIH-1) modulates protein interactions of apoptosis-stimulating p53 binding protein 2 (ASPP2).
23528480 2013 Helicobacter pylori infection and expressions of apoptosis-related proteins p53, ASPP2 and iASPP in gastric cancer and precancerous lesions.
23472201 2013 Regulation of ASPP2 interaction with p53 core domain by an intramolecular autoinhibitory mechanism.
23392125 2013 ASPP1 and ASPP2 bind active RAS, potentiate RAS signalling and enhance p53 activity in cancer cells.
23248303 2013 N terminus of ASPP2 binds to Ras and enhances Ras/Raf/MEK/ERK activation to promote oncogene-induced senescence.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088536 2013 Molecular mechanisms underlying the interaction of protein phosphatase-1c with ASPP proteins.
22552744 2012 Abnormal expression pattern of the ASPP family of proteins in human non-small cell lung cancer and regulatory functions on apoptosis through p53 by iASPP.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
22169642 2011 [Promoter methylation of ASPP1 and ASPP2 genes in non-small cell lung cancers].
21998301 2011 Inhibitory member of the apoptosis-stimulating proteins of the p53 family (iASPP) interacts with protein phosphatase 1 via a noncanonical binding motif.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21562218 2011 Helicobacter pylori cytotoxin-associated gene A (CagA) subverts the apoptosis-stimulating protein of p53 (ASPP2) tumor suppressor pathway of the host.
21513714 2011 The ASPP proteins complex and cooperate with p300 to modulate the transcriptional activity of p53.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21189257 2011 PP1 cooperates with ASPP2 to dephosphorylate and activate TAZ.
21183427 2010 Cell type specific expression of the apoptosis stimulating protein (ASPP-2) in human tissues.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20034025 2010 Epigenetic silence of ankyrin-repeat-containing, SH3-domain-containing, and proline-rich-region- containing protein 1 (ASPP1) and ASPP2 genes promotes tumor growth in hepatitis B virus-positive hepatocellular carcinoma.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19539330 2009 The bcl2 -938CC genotype has poor prognosis and lower survival in renal cancer.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19507243 2009 A model for the interaction between NF-kappa-B and ASPP2 suggests an I-kappa-B-like binding mechanism.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19377511 2009 The DEAD box protein Ddx42p modulates the function of ASPP2, a stimulator of apoptosis.
19246451 2009 Insight into the structural basis of pro- and antiapoptotic p53 modulation by ASPP proteins.
18793611 2008 p53 target DDA3 binds ASPP2 and inhibits its stimulation on p53-mediated BAX activation.
18719108 2008 Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18448430 2008 The structure and interactions of the proline-rich domain of ASPP2.
17965023 2007 53BP2S, interacting with insulin receptor substrates, modulates insulin signaling.
17594908 2007 Solution structure of ASPP2 N-terminal domain (N-ASPP2) reveals a ubiquitin-like fold.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16620772 2006 A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16139958 2005 ASPP--Apoptotic specific regulator of p53.
16098144 2005 Inhibition of the 53BP2S-mediated apoptosis by nuclear factor kappaB and Bcl-2 family proteins.
16091363 2005 Control of ASPP2/(53BP2L) protein levels by proteasomal degradation modulates p53 apoptotic function.
15986435 2005 TP53BP2 locus is associated with gastric cancer susceptibility.
15782125 2005 Mdm2 and mdmX prevent ASPP1 and ASPP2 from stimulating p53 without targeting p53 for degradation.
15757645 2005 Downregulated mRNA expression of ASPP and the hypermethylation of the 5'-untranslated region in cancer cell lines retaining wild-type p53.
15731768 2005 ASPP1 and ASPP2 are new transcriptional targets of E2F.
15592436 2005 Apoptosis-stimulating protein of p53-2 (ASPP2/53BP2L) is an E2F target gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14985081 2004 Hepatitis C virus core protein interacts with p53-binding protein, 53BP2/Bbp/ASPP2, and inhibits p53-mediated apoptosis.
14766226 2004 Expression of 53BP2 and ASPP2 proteins from TP53BP2 gene by alternative splicing.
14729977 2004 ASPP1 and ASPP2: common activators of p53 family members.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12694406 2003 ASPP2 inhibits APP-BP1-mediated NEDD8 conjugation to cullin-1 and decreases APP-BP1-induced cell proliferation and neuronal apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11684014 2001 ASPP proteins specifically stimulate the apoptotic function of p53.
11278422 2001 Yes-associated protein and p53-binding protein-2 interact through their WW and SH3 domains.
11027272 2000 Proapoptotic p53-interacting protein 53BP2 is induced by UV irradiation but suppressed by p53.
10646860 2000 APCL, a central nervous system-specific homologue of adenomatous polyposis coli tumor suppressor, binds to p53-binding protein 2 and translocates it to the perinucleus.
10631318 2000 Aberrant overexpression of 53BP2 mRNA in lung cancer cell lines.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
10498867 1999 NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2.
9748285 1998 Stimulation of p53-mediated transcriptional activation by the p53-binding proteins, 53BP1 and 53BP2.
9345910 1997 Assignment of p53 binding protein (TP53BP2) to human chromosome band 1q42.1 by in situ hybridization.
9169421 1997 Identification of novel human WW domain-containing proteins by cloning of ligand targets.
8875926 1996 Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2.
8668206 1996 The p53-binding protein 53BP2 also interacts with Bc12 and impedes cell cycle progression at G2/M.
8549741 1995 Protein phosphatase 1 interacts with p53BP2, a protein which binds to the tumour suppressor p53.
8016121 1994 Two cellular proteins that bind to wild-type but not mutant p53.