Property Summary

NCBI Gene PubMed Count 97
PubMed Score 72.55
PubTator Score 72.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 2.7e-11
group 4 medulloblastoma 1855 9.1e-04
ovarian cancer 8520 3.1e-03
Down syndrome 499 1.7e-02
acute myeloid leukemia 783 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Chromosome 1q41-q42 deletion syndrome 4 4.083 2.0
Cancer 2499 3.487 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia 1.500 4.6e-02
Down syndrome 1.100 1.7e-02
group 4 medulloblastoma 1.200 9.1e-04
osteosarcoma -2.317 2.7e-11
ovarian cancer 1.200 3.1e-03

 GWAS Trait (1)

Gene RIF (59)

AA Sequence

MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFG      1 - 70
SQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQ     71 - 140
QIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKL    141 - 210
VEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQ    211 - 280
NAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPY    281 - 350
IQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADL    351 - 420
FPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQV    421 - 490
ANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIP    491 - 560
SVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSA    561 - 630
LTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPT    631 - 700
KLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSY    701 - 770
PSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDN    771 - 840
SPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRK    841 - 910
TGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQ    911 - 980
FGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGV    981 - 1050
QEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRI   1051 - 1120
KPRQRSLA                                                                 1121 - 1128
//

Text Mined References (107)

PMID Year Title