Property Summary

Ligand Count 5
NCBI Gene PubMed Count 8,030
PubMed Score 54026.30
PubTator Score 35081.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Li-Fraumeni syndrome 13 6.681 3.3
Adenoma 167 5.824 2.9
ADRENOCORTICAL CARCINOMA, HEREDITARY 1 0.0 0.0
Acute kidney injury 70 0.0 0.0
Adenocarcinoma 122 0.0 1.1
Adenocarcinoma Of Esophagus 14 0.0 0.0
Adenocarcinoma, Clear Cell 2 0.0 0.0
Adrenal Gland Neoplasms 11 0.0 0.0
Amyotrophic lateral sclerosis 451 0.0 0.0
Arsenic Poisoning 62 0.0 0.0
Balkan Nephropathy 6 0.0 0.0
Brain Ischemia 110 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Carcinoma 11493 0.0 0.0
Carcinoma, Adenoid Cystic 99 0.0 0.0
Carcinoma, Basal Cell 28 0.0 0.0
Carcinoma, Hepatocellular 228 0.0 0.0
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Carcinoma, Renal Cell 124 0.0 0.0
Carcinoma, Small Cell 9 0.0 0.0
Carcinoma, Squamous Cell 110 0.0 0.0
Carcinoma, Transitional Cell 32 0.0 0.0
Carcinoma, squamous cell of head and neck 31 0.0 0.0
Cardiomyopathy, Hypertrophic 24 0.0 0.0
Carotid Artery Diseases 11 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Central Nervous System Neoplasms 2 0.0 0.0
Cholangiocarcinoma 35 0.0 5.0
Chromosome 17 deletion 2 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Demyelinating Diseases 7 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Emphysema 12 0.0 0.0
Esophageal Neoplasms 69 0.0 0.0
Esophageal Squamous Cell Carcinoma 77 0.0 0.0
Gallbladder Neoplasms 10 0.0 0.0
Glioma 74 0.0 0.0
Hemangiosarcoma 18 0.0 0.0
Hypertension 396 0.0 0.0
Infertility, Female 28 0.0 0.0
Infertility, Male 46 0.0 0.0
Ischemia 28 0.0 0.0
Keratosis 37 0.0 0.0
Leukemia, Lymphocytic, Chronic, B-Cell 34 0.0 0.0
Leukemia, Megakaryoblastic, of Down Syndrome 8 0.0 0.0
Liver Diseases, Parasitic 9 0.0 0.0
Liver Neoplasms, Experimental 59 0.0 0.0
Liver neoplasms 130 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lymphoma, T-Cell 13 0.0 0.0
Lymphoma, T-Cell, Cutaneous 22 0.0 0.0
Melanoma 711 0.0 1.3
Mesothelioma, Malignant 105 0.0 0.0
Mouth Neoplasms 55 0.0 0.0
Myelodysplastic Syndromes 26 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Ovarian epithelial cancer 10 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Papilloma, Choroid Plexus 1 0.0 0.0
Penile Neoplasms 4 0.0 0.0
Polyploidy 4 0.0 0.0
Precursor Cell Lymphoblastic Leukemia-Lymphoma 49 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Pulmonary Disease, Chronic Obstructive 31 0.0 0.0
Sarcoma 62 0.0 0.0
Schizophrenia 1160 0.0 0.0
Sezary Syndrome 27 0.0 0.0
Skin Neoplasms 69 0.0 0.0
Small Cell Lung Carcinoma 41 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Thymoma 16 0.0 0.0
Thyroid Neoplasms 34 0.0 0.0
Urinary Bladder Neoplasms 114 0.0 0.0
Urogenital Neoplasms 3 0.0 0.0
Urologic Neoplasms 8 0.0 0.0
Vulvar Lichen Sclerosus 2 0.0 0.0
Wilms Tumor 28 0.0 0.0
adrenocortical carcinoma 1428 0.0 0.8
nasopharyngeal carcinoma 1058 0.0 0.0
osteosarcoma 7950 0.0 0.00123058044524203
psoriasis 6694 0.0 4.50594563446202E-6
Disease Target Count
Abnormality of metabolism/homeostasis 134
Acute blood cancer 6
Acute leukemia 15
Adenocarcinoma of lung (disorder) 60
Adenoid Cystic Carcinoma 99
Alcoholic Intoxication 34
Alcoholic Intoxication, Chronic 289
Amaurosis Fugax 8
Arterial thrombosis 9
Autosomal recessive predisposition 1442
Basal cell carcinoma 54
Bladder Neoplasm 112
Bleeding time prolonged 31
Chest Pain 38
Chronic Obstructive Airway Disease 37
Encephalopathy, progressive 6
Epilepsy 792
Epithelial ovarian cancer 9
Female infertility 30
Genitourinary Neoplasms 3
Giant Cell Glioblastoma 12
Headache 37
Hereditary Breast and Ovarian Cancer Syndrome 14
Hereditary nonpolyposis colorectal carcinoma 18
Hydrocephalus 152
Hypertensive disease 292
Hypertrophic Cardiomyopathy 117
Increased gastric cancer 21
Increased hepatocellular carcinoma risk 27
Increased incidence of hepatocellular carcinoma 27
Increased megakaryocyte count 6
Increased risk of pancreatic cancer 9
Leiomyosarcoma of uterus 13
Liver carcinoma 240
Lymphoma 81
Male infertility 206
Malignant neoplasm of pancreas 9
Malignant neoplasm of prostate 11
Malignant neoplasm of skin 15
Malignant tumor of colon 19
Mammary Neoplasms 425
Marijuana Abuse 31
Micronodular cirrhosis 12
Myocardial Infarction 151
Nasopharyngeal Neoplasms 9
Nausea 20
Neoplastic Cell Transformation 89
Nephroblastoma 51
Nervous System Neoplasms 8
Pancreatic Neoplasm 85
Pancreatic carcinoma, familial 8
Papilledema 11
Paresthesia 32
Pathological accumulation of air in tissues 10
Platelet morphology abnormal 9
Precursor Cell Lymphoblastic Leukemia Lymphoma 43
Progressive brain disease 6
Retinal Neoplasms 3
Retinoblastoma 19
Seizures 596
Small cell carcinoma of lung 45
Somatic mutation 61
Splenomegaly 190
Squamous cell carcinoma of esophagus 77
Squamous cell carcinoma of the head and neck 29
Subacute progressive viral hepatitis 9
T-Cell Lymphoma 13
Thrombocythemia, Essential 12
Thyroid Neoplasm 37
Transient Cerebral Ischemia 25
Transitional cell carcinoma of bladder 17
Tumors of Adrenal Cortex 3
Venous Thrombosis 47
Vomiting 116
breast carcinoma 1638
gallbladder neoplasm 10
gliosarcoma 18
malignant mesothelioma 3232
Disease Target Count Z-score Confidence
Cancer 2499 8.998 4.0

Expression

  Differential Expression (17)

Disease log2 FC p
ovarian cancer 1.200 1.5e-05
osteosarcoma -2.598 1.2e-03
psoriasis -3.400 4.5e-06
malignant mesothelioma -6.000 5.0e-10
adult high grade glioma 1.700 2.0e-04
astrocytic glioma 1.200 4.7e-03
Astrocytoma, Pilocytic 1.800 2.6e-07
atypical teratoid / rhabdoid tumor 2.900 1.0e-09
ependymoma 1.400 6.0e-03
glioblastoma 1.800 2.7e-06
group 3 medulloblastoma 1.900 3.1e-04
medulloblastoma, large-cell 2.400 1.5e-03
oligodendroglioma 1.800 2.2e-02
Polycystic ovary syndrome -1.072 1.3e-02
primitive neuroectodermal tumor 2.500 1.2e-05
Rheumatoid arthritis -1.400 4.4e-03
subependymal giant cell astrocytoma 1.024 2.5e-02
See source...

Gene

Protein-protein Interaction (4)

PDB (152)

Gene RIF (7988)

AA Sequence

MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA      1 - 70
PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT     71 - 140
CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN    141 - 210
TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGR    211 - 280
DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALEL    281 - 350
KDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD                               351 - 393
//

Text Mined References (8059)

PMID Year Title