Property Summary

NCBI Gene PubMed Count 59
PubMed Score 40.74
PubTator Score 52.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
esophageal adenocarcinoma 3.000 1.9e-02
psoriasis -1.600 2.7e-33
oligodendroglioma 1.200 1.1e-03
sonic hedgehog group medulloblastoma 3.300 5.6e-06
non-small cell lung carcinoma 1.500 2.9e-13
intraductal papillary-mucinous adenoma (... 2.500 6.7e-03
intraductal papillary-mucinous carcinoma... 1.900 4.9e-02
intraductal papillary-mucinous neoplasm ... 2.800 2.6e-02
colon cancer -3.000 1.4e-02
lung cancer 1.800 4.4e-03
pancreatic cancer 1.900 1.4e-05
Breast cancer 2.300 2.8e-02
cystic fibrosis -1.200 4.7e-04
lung adenocarcinoma 3.417 5.7e-06
pilocytic astrocytoma -2.100 1.0e-02
posterior fossa group A ependymoma -1.900 6.6e-04
nasopharyngeal carcinoma -1.400 1.3e-02
lung carcinoma 2.500 5.1e-25
breast carcinoma 1.300 1.6e-06
ductal carcinoma in situ 3.400 9.5e-03
invasive ductal carcinoma 3.700 1.1e-03
pituitary cancer -3.800 3.5e-05

Gene RIF (46)

PMID Text
26911390 TNRC9 GG genotype of rs3803662 is associated with increased breast cancer risk.
26239137 The TOX3 SNPs rs3803662 C > T, rs12443621 A > G and rs8051542 C > T were all correlated with increased risk of breast cancer in the European and Asian populations, but not in the African one.
26224856 data suggest that central inhibition of IL-1alpha or Tox3 overexpression during the acute phase of a CNS insult may be an effective means for preventing the loss of neurological function
25956309 TOX3 and FGFR2 are breast cancer susceptibility genes in BRCA1/2-wild-type breast cancer patients from Sardinian population.
25632947 TOX3 is expressed in mammary ER(+) epithelial cells and regulates ER target genes in luminal breast cancer
25531440 Single nucleotide polymorphism in TOX3 gene is associated with breast cancer risk.
25311971 Mutations in TOX3 are not common in Chinese Han women with polycystic ovary syndrome.
25142570 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD
24532140 These results indicate an additive effect of the TOX3 rs3803662 and 2q35 rs13387042 alleles for breast cancer risk.
24481062 The T-rs8051542 allele was significantly associated with ER-positive and HER2-negative carriers. No significant association existed between rs12443621, rs3803662, and rs3112612 polymorphisms and risk of breast cancer.
24446301 T allele and the TT genotype of the SNP rs38033662 is significantly associated with risk for breast cancer in Chinese Han women.
24069272 mutations of TOX3 are present at low frequency in tumours. Our results support that TOX3 should be further investigated to elucidate its role in breast cancer biology.
24069142 TOX3 rs3803662 might play an important role in the prognostic outcome and treatment of gastric cancer, especially perhaps further help in explaining the reduced risk of death associated with diffuse-type gastric cancer.
23468243 TOX3 loci plays a role in the male breast cancer susceptibility.
23447579 TNRC9 gene is amplified and associated with poor prognosis in advanced breast cancer. TNRC9 promotes cancer cell proliferation, migration, and survival both in vitro and in vivo. TNRC9 and BRCA1 expression are inversely correlated.
23270421 the minor allele of SNP rs3803662 was associated with shorter survival in breast cancer patients with luminal A tumours, with lower mRNA expression of TOX3
23110726 Depletion of TOX high mobility group box family member 3 (TOX3) by siRNA enhances HIV-1 Tat activation of HIV-1 LTR, which is not the results of increased Tat expression and release of CDK9/CCNT1 from 7SK snRNP, and activation of NF-kappaB
23021931 Evidence of association with mammographic density was found for variant rs3803662 (TOX3).
23001124 risk-associated SNPs modulate the affinity of chromatin for FOXA1 at distal regulatory elements, thereby resulting in allele-specific gene expression, which is exemplified by the effect of the rs4784227 SNP on the TOX3 gene within the 16q12.1 risk locus.
22496870 Compared with TOX4, expression of TOX1, TOX2 and TOX3 in normal lung was 25, 44, and 88%lower, respectively, supporting the premise that reduced promoter activity confers increased susceptibility to methylation during lung carcinogenesis.
21172805 TOX3 induces transcription in neuron depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex.
20703937 Polymorphisms of trinucleotide repeat containing 9 gene is associated with breast cancer.
20703937 Meta-analysis of gene-disease association. (HuGE Navigator)
20664043 findings strengthen the existing evidence that FGFR2-rs2981582 and TNRC9-rs3803662 are predominantly associated with ER-positive breast cancer
20605201 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20502973 Observational study of gene-disease association. (HuGE Navigator)
20417875 Observational study of gene-disease association. (HuGE Navigator)
20406955 Single nucleotide polymorphism in TOX3 is associated with breast cancer.
20406955 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332101 Observational study of gene-disease association. (HuGE Navigator)
20237344 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20213080 Suggest that genetic variants of TNRC9 may contribute to the development of estrogen receptor positive breast cancer in a Chinese population.
20145138 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20054709 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19856316 Low-risk variants of TNRC9 is associated with familial breast cancer.
19843670 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19789366 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19617217 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19232126 The polymorphism rs12443621 in TOX3 was associated with percent dense area in breast cancer.
19232126 Observational study of gene-disease association. (HuGE Navigator)
19094228 Observational study of gene-disease association. (HuGE Navigator)
18437204 Meta-analysis of gene-disease association. (HuGE Navigator)
18355772 Meta-analysis of gene-disease association. (HuGE Navigator)
17997823 Observational study of gene-disease association. (HuGE Navigator)
17997823 Heterozygote carriers and minor allele homozygote carriers for SNP rs3803662 near the TNCR9 gene were more likely to be diagnosed before the age of 60 years (P = 0.025) relative to major allele homozygote carriers

AA Sequence

MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPIT      1 - 70
PPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSH     71 - 140
TQVSQYRQDPSLIMRSIVHMTDAARSGVMPPAQLTTINQSQLSAQLGLNLGGASMPHTSPSPPASKSATP    141 - 210
SPSSSINEEDADEANRAIGEKRAAPDSGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNA    211 - 280
TFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLAST    281 - 350
NLTSSLLLNTPLSQHGTVSASPQTLQQSLPRSIAPKPLTMRLPMNQIVTSVTIAANMPSNIGAPLISSMG    351 - 420
TTMVGSAPSTQVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQHFQHHMQQHL    421 - 490
QQQQQHLQQQINQQQLQQQLQQRLQLQQLQHMQHQSQPSPRQHSPVASQITSPIPAIGSPQPASQQHQSQ    491 - 560
IQSQTQTQVLSQVSIF                                                          561 - 576
//

Text Mined References (60)

PMID Year Title
26911390 2016 TNRC9 rs12443621 and FGFR2 rs2981582 polymorphisms and breast cancer risk.
26239137 2015 Association of three SNPs in TOX3 and breast cancer risk: Evidence from 97275 cases and 128686 controls.
26224856 2015 IL-1? Gene Deletion Protects Oligodendrocytes after Spinal Cord Injury through Upregulation of the Survival Factor Tox3.
25956309 2015 Genome-wide association study of susceptibility loci for breast cancer in Sardinian population.
25632947 2015 TOX3 is expressed in mammary ER(+) epithelial cells and regulates ER target genes in luminal breast cancer.
25531440 2014 Associations of two common genetic variants with breast cancer risk in a chinese population: a stratified interaction analysis.
25327703 2014 Genome-wide association study of breast cancer in Latinas identifies novel protective variants on 6q25.
25311971 2014 Mutational analysis of TOX3 in Chinese Han women with polycystic ovary syndrome.
25142570 2014 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD.
24532140 2014 Association of genetic variants at TOX3, 2q35 and 8q24 with the risk of familial and early-onset breast cancer in a South-American population.
24493630 2014 A genome-wide association study of early-onset breast cancer identifies PFKM as a novel breast cancer gene and supports a common genetic spectrum for breast cancer at any age.
24481062 2014 Risk-association of five SNPs in TOX3/LOC643714 with breast cancer in southern China.
24446301 2014 A single nucleotide polymorphism of the TNRC9 gene associated with breast cancer risk in Chinese Han women.
24143190 2013 Genome-wide association study of breast cancer in the Japanese population.
24069272 2013 TOX3 mutations in breast cancer.
24069142 2013 A genetic polymorphism in TOX3 is associated with survival of gastric cancer in a Chinese population.
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23468243 2013 Association of low-penetrance alleles with male breast cancer risk and clinicopathological characteristics: results from a multicenter study in Italy.
23447579 2013 TNRC9 downregulates BRCA1 expression and promotes breast cancer aggressiveness.
23270421 2012 The risk allele of SNP rs3803662 and the mRNA level of its closest genes TOX3 and LOC643714 predict adverse outcome for breast cancer patients.
23021931 2013 Association analysis between breast cancer genetic variants and mammographic density in a large population-based study (Determinants of Density in Mammographies in Spain) identifies susceptibility loci in TOX3 gene.
23001124 2012 Breast cancer risk-associated SNPs modulate the affinity of chromatin for FOXA1 and alter gene expression.
23001122 2012 Genome-wide association study identifies a common variant in RAD51B associated with male breast cancer risk.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
22496870 2012 Differential epigenetic regulation of TOX subfamily high mobility group box genes in lung and breast cancers.
21779176 2011 Genome-wide association study identifies novel restless legs syndrome susceptibility loci on 2p14 and 16q12.1.
21263130 2011 Novel breast cancer susceptibility locus at 9q31.2: results of a genome-wide association study.
21172805 2011 TOX3 is a neuronal survival factor that induces transcription depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex.
20872241 2011 A combined analysis of genome-wide association studies in breast cancer.
20703937 2011 Association between polymorphisms of trinucleotide repeat containing 9 gene and breast cancer risk: evidence from 62,005 subjects.
20664043 2010 Incidence of breast cancer and its subtypes in relation to individual and multiple low-penetrance genetic susceptibility loci.
20605201 2010 Gene-environment interactions in 7610 women with breast cancer: prospective evidence from the Million Women Study.
20585626 2010 Identification of a functional genetic variant at 16q12.1 for breast cancer risk: results from the Asia Breast Cancer Consortium.
20502973 2010 Breast cancer susceptibility variants alter risk in familial ovarian cancer.
20453838 2010 Genome-wide association study identifies five new breast cancer susceptibility loci.
20417875 2010 Distribution of FGFR2, TNRC9, MAP3K1, LSP1, and 8q24 alleles in genetically enriched breast cancer patients versus elderly tumor-free women.
20406955 2010 Polymorphisms in the TOX3/LOC643714 locus and risk of breast cancer in African-American women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332101 2010 Fine scale mapping of the breast cancer 16q12 locus.
20237344 2010 Performance of common genetic variants in breast-cancer risk models.
20213080 2010 Genetic variants in trinucleotide repeat-containing 9 (TNRC9) are associated with risk of estrogen receptor positive breast cancer in a Chinese population.
20145138 2010 Common genetic variants associated with breast cancer and mammographic density measures that predict disease.
20054709 2010 Birth weight, breast cancer susceptibility loci, and breast cancer risk.
19856316 2010 Low-risk variants FGFR2, TNRC9 and LSP1 in German familial breast cancer patients.
19843670 2009 Association of breast cancer susceptibility variants with risk of pancreatic cancer.
19789366 2009 Evaluation of 11 breast cancer susceptibility loci in African-American women.
19617217 2010 Breast cancer susceptibility variants alter risks in familial disease.
19330030 2009 A multistage genome-wide association study in breast cancer identifies two new risk alleles at 1p11.2 and 14q24.1 (RAD51L1).
19232126 2009 Association between breast cancer susceptibility loci and mammographic density: the Multiethnic Cohort.
19094228 2008 The influence of genetic variation in 30 selected genes on the clinical characteristics of early onset breast cancer.
18437204 2008 Heterogeneity of breast cancer associations with five susceptibility loci by clinical and pathological characteristics.
18355772 2008 Common breast cancer-predisposition alleles are associated with breast cancer risk in BRCA1 and BRCA2 mutation carriers.
17997823 2007 Clinical correlates of low-risk variants in FGFR2, TNRC9, MAP3K1, LSP1 and 8q24 in a Dutch cohort of incident breast cancer cases.
17529974 2007 Common variants on chromosomes 2q35 and 16q12 confer susceptibility to estrogen receptor-positive breast cancer.
17529967 2007 Genome-wide association study identifies novel breast cancer susceptibility loci.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12697058 2003 TOX defines a conserved subfamily of HMG-box proteins.
9225980 1997 cDNAs with long CAG trinucleotide repeats from human brain.