Property Summary

NCBI Gene PubMed Count 26
PubMed Score 990.49
PubTator Score 284.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 6.200 2.1e-09
cutaneous lupus erythematosus 2.000 2.3e-02
osteosarcoma -2.280 5.7e-07
atypical teratoid / rhabdoid tumor -1.700 1.3e-03
glioblastoma -1.400 1.7e-02
medulloblastoma -1.100 3.6e-02
medulloblastoma, large-cell -2.800 2.4e-03
intraductal papillary-mucinous carcinoma... 3.100 1.1e-03
colon cancer -2.400 7.0e-04
lung cancer 1.900 7.8e-04
active Crohn's disease 1.042 4.5e-02
adult high grade glioma -1.300 1.5e-02
posterior fossa group B ependymoma -1.200 3.9e-04
primary Sjogren syndrome 2.000 1.1e-04
lung carcinoma 2.600 1.1e-42

Gene RIF (13)

PMID Text
26139146 Significant associations between single nucleotide polymorphisms in TOX, CDKN2A/B and type 2 diabetes meillitus.
26125895 The SLC2A9 (rs7660895) and TOX (rs11777927) gene polymorphisms may be associated with formation of intracranial aneurysms, and rs7660895 may be associated with intracranial aneurysms rupture.
25548321 High TOX transcript levels correlate with increased cutaneous T-cell lymphoma.
25216799 TOX may be a specific marker for tumour cells in some types of cutaneous lymphoma.
23415668 SNP rs2726600 is located in a transcription-factor binding site in the 3' region of TOX.
22496870 Compared with TOX4, expression of TOX1, TOX2 and TOX3 in normal lung was 25, 44, and 88%lower, respectively, supporting the premise that reduced promoter activity confers increased susceptibility to methylation during lung carcinogenesis.
21126536 results suggest that TOX is required for IL-15-mediated natural killer (NK) cell differentiation and affected expression of T-bet that plays critical roles in NK differentiation and maturation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
17918249 Observational study of gene-disease association. (HuGE Navigator)
17529974 Observational study of gene-disease association. (HuGE Navigator)
15078895 expression of the HMG box protein TOX is sufficient to induce changes in coreceptor gene expression associated with beta-selection, including CD8 gene demethylation

AA Sequence

MDVRFYPPPAQPAAAPDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNI      1 - 70
PPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQNMDLPEITVSNMLGQDGTLLSNSISVMPD     71 - 140
IRNPEGTQYSSHPQMAAMRPRGQPADIRQQPGMMPHGQLTTINQSQLSAQLGLNMGGSNVPHNSPSPPGS    141 - 210
KSATPSPSSSVHEDEGDDTSKINGGEKRPASDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIK    211 - 280
GQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYSEPVDVKTSQPPQ    281 - 350
LINSKPSVFHGPSQAHSALYLSSHYHQQPGMNPHLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPP    351 - 420
LQISPPLHQHLNMQQHQPLTMQQPLGNQLPMQVQSALHSPTMQQGFTLQPDYQTIINPTSTAAQVVTQAM    421 - 490
EYVRSGCRNPPPQPVDWNNDYCSSGGMQRDKALYLT                                      491 - 526
//

Text Mined References (27)

PMID Year Title
26139146 2015 TOX and CDKN2A/B Gene Polymorphisms Are Associated with Type 2 Diabetes in Han Chinese.
26125895 2015 Intracranial aneurysm risk factor genes: relationship with intracranial aneurysm risk in a Chinese Han population.
25548321 2015 Evidence of an oncogenic role of aberrant TOX activation in cutaneous T-cell lymphoma.
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
25233373 2014 Genome-wide meta-analysis of myopia and hyperopia provides evidence for replication of 11 loci.
25216799 2014 TOX expression in different subtypes of cutaneous lymphoma.
23415668 2013 Age-dependent association between pulmonary tuberculosis and common TOX variants in the 8q12-13 linkage region.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22496870 2012 Differential epigenetic regulation of TOX subfamily high mobility group box genes in lung and breast cancers.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
21126536 2011 TOX regulates the differentiation of human natural killer cells from hematopoietic stem cells in vitro.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18195075 2008 Development of all CD4 T lineages requires nuclear factor TOX.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17918249 2008 Fetal hemoglobin in sickle cell anemia: Bayesian modeling of genetic associations.
17529974 2007 Common variants on chromosomes 2q35 and 16q12 confer susceptibility to estrogen receptor-positive breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15078895 2004 TOX provides a link between calcineurin activation and CD8 lineage commitment.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12697058 2003 TOX defines a conserved subfamily of HMG-box proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11850626 2002 TOX: an HMG box protein implicated in the regulation of thymocyte selection.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.