Property Summary

NCBI Gene PubMed Count 13
PubMed Score 122.57
PubTator Score 38.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.200 1.6e-06
group 3 medulloblastoma 1.700 2.4e-04
intraductal papillary-mucinous neoplasm ... 1.500 7.2e-04
osteosarcoma -2.999 4.8e-07
ovarian cancer 1.600 3.8e-04
psoriasis -1.800 4.1e-04

Gene RIF (4)

AA Sequence

MLRGPWRQLWLFFLLLLPGAPEPRGASRPWEGTDEPGSAWAWPGFQRLQEQLRAAGALSKRYWTLFSCQV      1 - 70
WPDDCDEDEEAATGPLGWRLPLLGQRYLDLLTTWYCSFKDCCPRGDCRISNNFTGLEWDLNVRLHGQHLV     71 - 140
QQLVLRTVRGYLETPQPEKALALSFHGWSGTGKNFVARMLVENLYRDGLMSDCVRMFIATFHFPHPKYVD    141 - 210
LYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGPHLERRAPEGHRAESPWTIFLFLSNLRGDII    211 - 280
NEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDA    281 - 350
FLSQELLYKEETLDEIAQMMVYVPKEEQLFSSQGCKSISQRINYFLS                           351 - 397
//

Text Mined References (14)

PMID Year Title