Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.38
PubTator Score 44.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.307 4.5e-02
Multiple myeloma 1.885 2.1e-03
oligodendroglioma 1.200 7.8e-03
osteosarcoma 3.521 2.1e-08
ependymoma 1.400 9.1e-09
medulloblastoma, large-cell -1.500 1.8e-04
lung cancer -1.200 6.2e-03
Breast cancer 2.900 4.3e-02
aldosterone-producing adenoma -1.799 6.9e-03
invasive ductal carcinoma -1.162 6.4e-03
ovarian cancer -2.400 6.4e-08

Gene RIF (6)

PMID Text
25323962 LAP1 co-localizes with acetylated alpha-tubulin in the mitotic spindle and with gamma-tubulin in centrosomes (main microtubule organizing center) in mitotic cells.
25149450 Data show that mutation of arginine 563 in lamina-associated polypeptide 1 (LAP1) reduces its ability to stimulate TorsinA ATPase hydrolysis.
24856141 study described a new autosomal recessive nuclear envelope disease caused by a homozygous mutation in exon 1 of TOR1AIP1 encoding LAP1B; study expands the spectrum of genes associated with nuclear envelopathies and highlights critical function for LAP1B in striated muscle
24116158 Data indicate that the protein phosphatase 1 (PP1) binding domain in nuclear membrane protein lamina associated polypeptide 1B (LAP1B) was here identified as the REVRF motif at amino acids 55-59.
19454010 Interaction of HIV-1 Tat with lamina-associated polypeptide 1B in T-cells is identified by a proteomic strategy based on affinity chromatography
12061773 Molecular cloning of LAP1B & the role of the protein domains in localization of LAP1B to nuclear and endoplasmic reticulum membranes was determined

AA Sequence

MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDF      1 - 70
EPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPL     71 - 140
QPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQ    141 - 210
KVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLS    211 - 280
SGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASG    281 - 350
SFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEE    351 - 420
ALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTL    421 - 490
IFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGL    491 - 560
WSRISHLVLPVQPENALKRGICL                                                   561 - 583
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25323962 2015 LAP1 is a crucial protein for the maintenance of the nuclear envelope structure and cell cycle progression.
25149450 2014 How lamina-associated polypeptide 1 (LAP1) activates Torsin.
24856141 2014 Mutation in TOR1AIP1 encoding LAP1B in a form of muscular dystrophy: a novel gene related to nuclear envelopathies.
24275647 2014 Arresting a Torsin ATPase reshapes the endoplasmic reticulum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116158 2013 The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate.
23569223 2013 Regulation of Torsin ATPases by LAP1 and LULL1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365922 2012 Interactions between the ROP18 kinase and host cell proteins that aid in the parasitism of Toxoplasma gondii.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19382019 2009 Effect of (211)At alpha-particle irradiation on expression of selected radiation responsive genes in human lymphocytes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16361107 2006 Dystonia-causing mutant torsinA inhibits cell adhesion and neurite extension through interference with cytoskeletal dynamics.
15767459 2005 The AAA+ protein torsinA interacts with a conserved domain present in LAP1 and a novel ER protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12061773 2002 Molecular cloning of one isotype of human lamina-associated polypeptide 1s and a topological analysis using its deletion mutants.
9305626 1997 The inner nuclear membrane protein LAP1 forms a native complex with B-type lamins and partitions with spindle-associated mitotic vesicles.
8324822 1993 Integral membrane proteins of the nuclear envelope interact with lamins and chromosomes, and binding is modulated by mitotic phosphorylation.