Property Summary

NCBI Gene PubMed Count 79
PubMed Score 235.45
PubTator Score 203.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Abdominal abscess 2
Acute Moraxella catarrhalis bronchitis 1
Acute bacterial bronchitis 1
Acute bacterial peritonitis 1
Acute bacterial sinusitis 1
Acute gonococcal cervicitis 1
Acute gonococcal urethritis 1
Acute maxillary sinusitis 3
Acute osteomyelitis 1
Anthrax 1
Bacterial Corneal Ulcer Infection 1
Bacterial conjunctivitis 10
Bacterial infection due to Klebsiella pneumoniae 2
Bacterial pneumonia 3
Bacterial urinary infection 2
Chancroid 8
Chronic Bacterial Prostatitis 1
Citrobacter Urinary Tract Infection 1
Complicated Bacterial Peritonitis 1
Complicated Bacteroides Peritonitis 1
Complicated E. Coli Peritonitis 1
Complicated Klebsiella Peritonitis 1
Complicated Proteus UTI 1
Complicated UTI with Pseudomonas Aeruginosa 1
Cystitis 16
Diarrhea due to E. Coli 1
E. Coli Cystitis 1
E. Coli Pyelonephritis 1
Enteric campylobacteriosis 1
Enterobacter Osteomyelitis 1
Enterobacter Pneumonia 2
EnterobacterJoint Infection 1
Enterococcus Complicated UTI 1
Enterococcus Urinary Tract Infection 1
Escherichia coli urinary tract infection 1
Gram-Negative Aerobic Bacillary Pneumonia 2
Haemophilus Parainfluenzae Pneumonia 1
Haemophilus influenzae pneumonia 2
Infection due to Enterobacteriaceae 1
Infection due to Escherichia coli 1
Infection due to Pseudomonas aeruginosa 1
Infection due to Staphylococcus aureus 1
Infection of bone 2
Infection of skin AND/OR subcutaneous tissue 2
Infectious diarrheal disease 1
Infectious disease of abdomen 2
Infectious disorder of joint 2
Infective cystitis 1
Infective otitis externa 4
Infective otitis media 3
Klebsiella Complicated UTI 1
Klebsiella Nosocomial Pneumonia 1
Klebsiella cystitis 1
Lower respiratory tract infection 2
Malignant otitis externa due to Pseudomonas aeruginosa 4
Moraxella Catarrhalis Chronic Bronchitis 1
Morganella Morganii Urinary Tract Infection 1
Nosocomial Pneumonia due to Haemophilus Influenzae 1
Nosocomial pneumonia 1
Otitis externa 9
Pneumonia due to Escherichia coli 2
Pneumonia due to Pseudomonas 1
Pneumonia due to Streptococcus 2
Prostatitis 15
Proteus Prostatitis 1
Proteus pneumonia 1
Proteus urinary tract infection 1
Providencia Urinary Tract Infection 1
Pseudomonas Aeruginosa Joint Infection 1
Pseudomonas Aeruginosa Osteomyelitis 1
Pseudomonas Aeruginosa Urinary Tract Infection 1
Rhinoscleroma 5
Septicemia due to Escherichia coli 1
Serratia Joint Infection 1
Serratia Osteomyelitis 1
Serratia Urinary Tract Infection 1
Shigellosis 16
Skin and Skin Structure Citrobacter Infection 1
Skin and Skin Structure Morganella Morganii Infection 1
Skin and Skin Structure Proteus Infection 1
Skin and Skin Structure Providencia Infection 1
Skin and Skin Structure Pseudomonas Aeruginosa Infection 1
Skin and Skin Structure Serratia Infection 1
Staphylococcus Aureus Otitis Externa 4
Staphylococcus Cystitis 1
Staphylococcus Epidermidis Skin and Skin Structure Infection 1
Staphylococcus Epidermidis Urinary Tract Infection 1
Staphylococcus Saprophyticus Urinary Tract Infection 1
Streptococcus pyogenes infection 1
Typhoid fever 22
Disease Target Count P-value
lung cancer 4473 1.8e-04
dermatomyositis 966 4.6e-04
Waldenstrons macroglobulinemia 764 2.4e-03
group 3 medulloblastoma 2254 1.7e-02
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.433 2.2
Vaccinia 37 3.116 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.858 2.4e-03
lung cancer 1.300 1.8e-04
group 3 medulloblastoma 1.100 1.7e-02
dermatomyositis 1.200 4.6e-04

Protein-protein Interaction (3)

Gene RIF (47)

PMID Text
26876283 TopoIIbeta is involved in the cascade of coactivator complexes that are recruited to LTR for regulation of HIV-1 transcription.
26612825 during early development, TOP2A is likely to have a role in cell proliferation, whereas TOP2B is expressed in post-mitotic cells and may be important in controlling expression of long genes even at this early stage.
26055322 A direct interaction between Ku70/86 and BRG1 brings together SWI/SNF remodeling capabilities and TOP2beta activity to enhance the transcriptional response to hormone stimulation.
25815590 Cinobufacini inhibited the proliferation of the HepG-2 cells induced apoptosis in a dose- and time-dependent manner and downregulated the mRNA and protein expression levels of TOPO I and TOPO II
25217229 Data suggest that DNA topoisomerase IIbeta (topoIIbeta) silencing can significantly alter the gene expression pattern of genes involved in variety of biological processes and signal transduction pathways.
25011107 Human cytomegalovirus IE1 exon 4 interacts with Topoisomerase IIbeta (TOPOIIbeta), whose activity is required for viral genome persistence and maintenance via binding to a cis-acting viral maintenance element.
24808172 Proteolytic degradation of Top2 enables the processing of Top2.DNA and Top2.RNA covalent complexes by TDP2.
24801450 This study demonstrated that top IIbeta overexpression is necessary for RA-induced neuronal differentiation.
24766193 These results are consistent with the hypothesis that etoposide quinone contributes to etoposide-related leukemogenesis through an interaction with topoisomerase IIbeta.
24326092 There is an association between chemosensitivity and Pgp, GST-pi and Topo II expression in gastric cancer.
23938298 Top2beta-DNA cleavage complexes arrest transcription elongation and induce a proteasomal degradation of Top2beta on DNA.
23696245 Downregulating topoisomerase IIbeta confers resistance specifically to mitoxantrone.
23399433 HIV-1 RT co-localizes with TOP2A and TOP2B in cytosol of HIV-1 infected Sup T1 and PBMC cells
23399433 Knockdown of TOP2A, TOP2B, or TOP2A/2B by siRNA significantly decreases HIV-1 replication in Sup T1 cells
21793937 results suggest that the low expression of TOPOIIbeta in patients with tongue carcinoma indicates that intrinsic drug resistance may exist in tongue carcinoma, and is associated with tumor differentiation and cisplatin resistance in tongue carcinoma.
21542140 Overexpression of Lewis(y) antigen confers cell adhesion-mediated drug resistance to apoptosis in ovarian cancer cells by the upregulation of Topo-I and Topo-II beta.
21280220 Tyrosine 656 in topoisomerase II beta is important for the catalytic activity of the enzyme.
20882068 [review] Accumulating studies show the significant role of Top IIbeta in neuronal development through regulating expression of certain genes in cells committed to the neuronal fate after the final division.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902255 Data show significant associations between SNPs in RARA, RARB, TOP2B and RARG, RXRA, TLR3, TRIM5 and RIG-I genes and rubella virus-specific cytokine immune responses.
19902255 Observational study of gene-disease association. (HuGE Navigator)
19222228 Data show a difference in metal ion utilization during DNA cleavage mediated by human topoisomerase IIalpha and IIbeta.
19181665 NRF-1 can also directly interact with poly(ADP-ribose) polymerase 1 (PARP-1) and co-purify the PARP-1.DNA-PK.Ku80.Ku70.topoisomerase IIbeta-containing protein complex.
18212063 TopoIIbeta binds a retinoic acid response element. Inhibition causes hyperacetylation of histone 3 at lysine 9 & transcription activation.Increased levels of & association with TopoIIbeta cause resistance to RA in acute promyelocytic leukemia cell lines.
17526531 The C-terminal region of human topoisomerase II beta determines its isoform-specific functions in proliferating cells.
17361331 Topo IIalpha and beta mRNA expression, but not the Topo IIalpha labeling index, might be a useful marker for sensitivity to etoposide in human malignant neuroepithelial tumors.
17209120 directed mutation of TOP2B demonstrated missense mutations selected for acridine resistance varied with acridine structure
17182034 We conclude that topo II alpha and beta nuclear export is inhibited in proliferating cells so that these proteins do not shuttle.
16969495 EGF may have a role in drug resistance in cultured tumor cells through the downregulation of topoII
16932348 Reduced expression of topo IIbeta induces apoptosis in part by impairing the anti-oxidant capacity of the cell owing to downregulation of PRDX2.
16794079 reported that signal-dependent activation of gene transcription by nuclear receptors and other classes of transcription factors requires DNA topoisomerase IIbeta-dependent, transient, site-specific dsDNA break formation
16712776 Topoisomerase II alpha and beta isoforms are present in the pre-integration complexes, suggesting their significant role in HIV-1 replication.
16502015 TOP2A may have a role in response to doxorubicin-based chemotherapy
16091284 Further analysis of purified virus showed that HIV-1 virion contained topoisomerase II isoform-specific kinase activities, which were partially isolated
15680922 This is the first report that conjugated PUFA such as cEPA act as inhibitors of pols and topos.
15044480 UVA-modified DNA is preferentially targeted and processed by topoisomerase IIalpha and IIbeta.
14996935 When both topo IIalpha and topo IIbeta were removed, the segregation of chromosomes was severely arrested, suggesting that topo IIbeta could partially substitute for topo IIalpha.
14723357 Topoisomerase II is a potential target for new antilesishmanial drug development.
14596941 demonstrated that neither A or B isoform has any preference for a specific DNA conformation as substrate under the conditions used in these experiments
12821127 topoisomerase II is actively exported from the nuclease and is mediated by a CRM1-dependent pathway
12629207 proteasomal degradation of TOP2beta induced by the TOP2-DNA covalent complex or the TOP2 circular clamp is due to transcriptional arrest but not DNA damage
12197834 analysis of binding sites for NF-Y and Sp1, which are critical for TOP2B transcription
12105221 shows for the first time that topoisomerase II beta is a substrate for PKC zeta, and that PKC zeta may significantly influence topoisomerase II inhibitor-induced cytotoxicity by altering topoisomerase II beta activity through its kinase function
11927602 topo II is not an immobile, structural component of the chromosomal scaffold or the interphase karyoskeleton, but rather a dynamic interaction partner of such structures.

AA Sequence

MAKSGGCGAGAGVGGGNGALTWVTLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQLEHILLRPDT      1 - 70
YIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIW     71 - 140
NNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHS    141 - 210
FKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNG    211 - 280
KKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYV    281 - 350
VDQVVGKLIEVVKKKNKAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFF    351 - 420
KAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLA    421 - 490
VSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIM    491 - 560
TDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWK    561 - 630
IKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHG    631 - 700
LPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAG    701 - 770
SVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFP    771 - 840
AVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPML    841 - 910
PNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKE    911 - 980
YHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSY    981 - 1050
YGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAE   1051 - 1120
EDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLA   1121 - 1190
AFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKK   1191 - 1260
KKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSAKKVK   1261 - 1330
KRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDDDDDNNDLEELKVKAS   1331 - 1400
PITNDGEDEFVPSDGLDKDEYTFSPGKSKATPEKSLHDKKSQDFGNLFSFPSYSQKSEDDSAKFDSNEED   1401 - 1470
SASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGK   1471 - 1540
GRGAKKRKASGSENEGDYNPGRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGRARKEVKYF   1541 - 1610
AESDEEEDDVDFAMFN                                                         1611 - 1626
//

Text Mined References (97)

PMID Year Title
26876283 2016 TopoisomeraseII? in HIV-1 transactivation.
26612825 2016 Distinct expression patterns for type II topoisomerases IIA and IIB in the early foetal human telencephalon.
26055322 2015 Glucocorticoid Receptor Transcriptional Activation via the BRG1-Dependent Recruitment of TOP2? and Ku70/86.
25815590 2015 Effects of cinobufacini injection on cell proliferation and the expression of topoisomerases in human HepG-2 hepatocellular carcinoma cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25217229 2015 DNA topoisomerase II? as a molecular switch in neural differentiation of mesenchymal stem cells.
25011107 2014 Maintenance and replication of the human cytomegalovirus genome during latency.
24808172 2014 Proteolytic degradation of topoisomerase II (Top2) enables the processing of Top2·DNA and Top2·RNA covalent complexes by tyrosyl-DNA-phosphodiesterase 2 (TDP2).
24801450 2014 Specificity protein 1 regulates topoisomerase II? expression in SH-SY5Y cells during neuronal differentiation.
24766193 2014 Etoposide quinone is a covalent poison of human topoisomerase II?.
24326092 2013 The association between chemosensitivity and Pgp, GST-? and Topo II expression in gastric cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23938298 2013 Activation of a novel ubiquitin-independent proteasome pathway when RNA polymerase II encounters a protein roadblock.
23696245 2013 Overexpression of Mcl-1 confers multidrug resistance, whereas topoisomerase II? downregulation introduces mitoxantrone-specific drug resistance in acute myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22111588 2011 Maternal topoisomerase II alpha, not topoisomerase II beta, enables embryonic development of zebrafish top2a-/- mutants.
21793937 2012 The expression and significance of MRP1, LRP, TOPOII?, and BCL2 in tongue squamous cell carcinoma.
21778401 2011 Structural basis of type II topoisomerase inhibition by the anticancer drug etoposide.
21542140 2011 Overexpression of Lewis(y) antigen protects ovarian cancer RMG-1 cells from carboplatin-induced apoptosis by the upregulation of Topo-I and Topo-II ?.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21280220 2011 Tyrosine 656 in topoisomerase II? is important for the catalytic activity of the enzyme: Identification based on artifactual +80-Da modification at this site.
21269460 2011 Initial characterization of the human central proteome.
20882068 2010 The function of DNA topoisomerase II? in neuronal development.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902255 2010 Rubella vaccine-induced cellular immunity: evidence of associations with polymorphisms in the Toll-like, vitamin A and D receptors, and innate immune response genes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19222228 2009 Use of divalent metal ions in the dna cleavage reaction of human type II topoisomerases.
19181665 2009 Poly(ADP-ribose) Polymerase 1 Interacts with Nuclear Respiratory Factor 1 (NRF-1) and Plays a Role in NRF-1 Transcriptional Regulation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18212063 2008 Topoisomerase IIbeta negatively modulates retinoic acid receptor alpha function: a novel mechanism of retinoic acid resistance.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17567603 2007 Nuclear interactions of topoisomerase II alpha and beta with phospholipid scramblase 1.
17526531 2007 C-terminal regions of topoisomerase IIalpha and IIbeta determine isoform-specific functioning of the enzymes in vivo.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17361331 2007 Enhanced expression of DNA topoisomerase II genes in human medulloblastoma and its possible association with etoposide sensitivity.
17209120 2007 Differential selection of acridine resistance mutations in human DNA topoisomerase IIbeta is dependent on the acridine structure.
17182034 2007 Topoisomerase II binds importin alpha isoforms and exportin/CRM1 but does not shuttle between the nucleus and cytoplasm in proliferating cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16969495 2006 Epidermal growth factor induction of resistance to topoisomerase II toxins in human squamous carcinoma A431 cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16932348 2006 Downregulation of topoisomerase IIbeta in myeloid leukemia cell lines leads to activation of apoptosis following all-trans retinoic acid-induced differentiation/growth arrest.
16794079 2006 A topoisomerase IIbeta-mediated dsDNA break required for regulated transcription.
16712776 2006 A study of the topoisomerase II activity in HIV-1 replication using the ferrocene derivatives as probes.
16611985 2006 Protein kinase C delta activates topoisomerase IIalpha to induce apoptotic cell death in response to DNA damage.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16502015 2006 Topoisomerase II-alpha gene deletion is not frequent as its amplification in breast cancer.
16091284 2005 A biochemical analysis of topoisomerase II alpha and beta kinase activity found in HIV-1 infected cells and virus.
15680922 2005 Inhibitory effect of conjugated eicosapentaenoic acid on human DNA topoisomerases I and II.
15635413 2005 Nucleolar proteome dynamics.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15044480 2004 Enhanced processing of UVA-irradiated DNA by human topoisomerase II in living cells.
14996935 2004 Functional compatibility between isoform alpha and beta of type II DNA topoisomerase.
14723357 2003 Characterization of Leishmania chagasi DNA topoisomerase II: a potential chemotherapeutic target.
14596941 2003 Kinetic analysis of human topoisomerase IIalpha and beta DNA binding by surface plasmon resonance.
12821127 2003 Identification of functional nuclear export sequences in human topoisomerase IIalpha and beta.
12629207 2003 The topoisomerase IIbeta circular clamp arrests transcription and signals a 26S proteasome pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393188 2002 Ku antigen, an origin-specific binding protein that associates with replication proteins, is required for mammalian DNA replication.
12197834 2002 Characterization of the human topoisomerase IIbeta (TOP2B) promoter activity: essential roles of the nuclear factor-Y (NF-Y)- and specificity protein-1 (Sp1)-binding sites.
12105221 2002 Overexpression of the atypical protein kinase C zeta reduces topoisomerase II catalytic activity, cleavable complexes formation, and drug-induced cytotoxicity in monocytic U937 leukemia cells.
11927602 2002 Dynamics of human DNA topoisomerases IIalpha and IIbeta in living cells.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11710515 2001 Mapping of the interaction domain of the protein kinase CKII beta subunit with target proteins.
11395412 2001 DNA topoisomerases: structure, function, and mechanism.
11136718 2001 Deacetylase activity associates with topoisomerase II and is necessary for etoposide-induced apoptosis.
11062478 2000 Histone deacetylase interacts directly with DNA topoisomerase II.
10879730 2000 Simultaneous quantitation of topoisomerase II alpha and beta isoform mRNAs in lung tumor cells and normal and malignant lung tissue.
10862613 2000 SUMO-1 conjugation to human DNA topoisomerase II isozymes.
10684600 2000 Mutagenesis of E477 or K505 in the B' domain of human topoisomerase II beta increases the requirement for magnesium ions during strand passage.
10666337 2000 Human topoisomerase IIalpha and IIbeta interact with the C-terminal region of p53.
10473615 1999 Using a biochemical approach to identify the primary dimerization regions in human DNA topoisomerase IIalpha.
10095062 1999 Molecular cloning and characterization of the human topoisomerase IIalpha and IIbeta genes: evidence for isoform evolution through gene duplication.
9795238 1998 Structural organization of the human TOP2A and TOP2B genes.
9743583 1998 Nuclear distribution of human DNA topoisomerase IIbeta: a nuclear targeting signal resides in the 116-residue C-terminal tail.
9461304 1997 A DNA-topoisomerase-II-binding protein with eight repeating regions similar to DNA-repair enzymes and to a cell-cycle regulator.
9426241 1997 Cloning and characterization of the 5'-flanking sequence for the human DNA topoisomerase II beta gene.
9168988 1997 Binding of wild-type p53 by topoisomerase II and overexpression of topoisomerase II in human hepatocellular carcinoma.
9155018 1997 MNK1, a new MAP kinase-activated protein kinase, isolated by a novel expression screening method for identifying protein kinase substrates.
9049244 1997 Cell cycle-coupled relocation of types I and II topoisomerases and modulation of catalytic enzyme activities.
8710863 1996 Active heterodimers are formed from human DNA topoisomerase II alpha and II beta isoforms.
8626450 1996 Specific interaction of topoisomerase II beta and the CD3 epsilon chain of the T cell receptor complex.
8396237 1993 Human cells express two differentially spliced forms of topoisomerase II beta mRNA.
8383537 1993 Novel HeLa topoisomerase II is the II beta isoform: complete coding sequence and homology with other type II topoisomerases.
2556712 1989 Characterization and immunological identification of cDNA clones encoding two human DNA topoisomerase II isozymes.
2163884 1990 Isolation and characterization of a human cDNA clone encoding a novel DNA topoisomerase II homologue from HeLa cells.
1333583 1992 Isolation of cDNA clones encoding the beta isozyme of human DNA topoisomerase II and localisation of the gene to chromosome 3p24.
1309226 1992 Topoisomerase II alpha and topoisomerase II beta genes: characterization and mapping to human chromosomes 17 and 3, respectively.