Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.20
PubTator Score 9.51

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.506 2.0e-03
chronic lymphosyte leukemia 1.100 1.1e-05
medulloblastoma, large-cell 1.600 2.0e-03
non-small cell lung cancer 1.020 4.0e-12
group 4 medulloblastoma -1.300 9.1e-03
ovarian cancer 1.100 2.8e-03

Gene RIF (5)

24172750 Data indicate that the different coordination geometry achieved by the two transition metal ions has an important role in modulating their efficiency as topoisomerase I inhibitors.
23422507 Data reported in this paper indicate that hTop IB does not confer to the cells radio-resistance, but the kinetic analysis of both DNA repair rate as well as colonies growth, demonstrates that the cells containing hTop IB show a more efficient rescue from IR injury.
23261817 DNA topoisomerase I stimulates BLM helicase activity on a nucleolar-relevant RNA:DNA hybrid.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

DPRISIAWCKRFRVPVEKIYSKTQRERFAWALAMAGEDFEF                                 561 - 601

Text Mined References (19)

PMID Year Title
24172750 2014 Effect of oxindolimine copper(II) and zinc(II) complexes on human topoisomerase I activity.
23422507 2013 Role of human topoisomerase IB on ionizing radiation induced damage.
23261817 Collaborating functions of BLM and DNA topoisomerase I in regulating human rDNA transcription.
21531700 2011 Coordinated regulation of mitochondrial topoisomerase IB with mitochondrial nuclear encoded genes and MYC.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19720733 2009 Adaptation of topoisomerase I paralogs to nuclear and mitochondrial DNA.
18826252 2008 Mitochondrial topoisomerase I sites in the regulatory D-loop region of mitochondrial DNA.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17161897 2007 Mitochondrial topoisomerases and alternative splicing of the human TOP1mt gene.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096574 2004 Thirteen-exon-motif signature for vertebrate nuclear and mitochondrial type IB topoisomerases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11526219 2001 Human mitochondrial topoisomerase I.