Property Summary

NCBI Gene PubMed Count 114
PubMed Score 158.94
PubTator Score 134.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.200 5.6e-04
malignant mesothelioma 1.200 1.2e-05

Gene RIF (73)

AA Sequence

MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAE      1 - 70
DGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQ     71 - 140
LSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDV    141 - 210
LVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASD    211 - 280
QLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKN    281 - 350
KFQCGFGLTIG                                                               351 - 361
//

Text Mined References (118)

PMID Year Title