Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.79
PubTator Score 14.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
interstitial cystitis 2299 5.0e-05
lung cancer 4473 2.9e-04
colon cancer 1475 4.4e-03
Disease Target Count Z-score Confidence
Colorectal Cancer 62 3.157 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.100 4.4e-03
lung cancer 1.400 2.9e-04
interstitial cystitis -1.300 5.0e-05

 GO Function (1)

Gene RIF (8)

PMID Text
24567332 These results suggest that Tomm34 represents a novel scaffolding co-chaperone of Hsp70 and Hsp90, which may facilitate Hsp70/Hsp90 cooperation during protein folding
23053644 TOMM34 expression in early invasive breast cancer: a biomarker associated with poor outcome.
22178133 Results identify Tom34 as a cochaperone of Hsp70/Hsp90 in mitochondrial protein import.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18364745 Data show that NRF-1 is the main transcription factor regulating the expression of TOMM34, and that Sp1 interacts with NRF-1 to stimulate the promoter's full activity.
16820880 TOMM34 is involved in the growth of colon cancer cells
11913976 Yeast two-hybrid screening identifies binding partners of human Tom34 that have ATPase activity and form a complex with Tom34 in the cytosol
11913975 Tom34 unlike Tom20 does not interact with the leader sequences of mitochondrial precursor proteins

AA Sequence

MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDC      1 - 70
IKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEW     71 - 140
RLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHK    141 - 210
KAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSS    211 - 280
FADISNLLQIEPRNGPAQKLRQEVKQNLH                                             281 - 309
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24567332 2014 The assembly and intermolecular properties of the Hsp70-Tomm34-Hsp90 molecular chaperone complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23053644 2012 TOMM34 expression in early invasive breast cancer: a biomarker associated with poor outcome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22178133 2012 Tom34: a cytosolic cochaperone of the Hsp90/Hsp70 protein complex involved in mitochondrial protein import.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
18364745 2008 NRF-1 is the major transcription factor regulating the expression of the human TOMM34 gene.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16820880 2006 Identification of TOMM34, which shows elevated expression in the majority of human colon cancers, as a novel drug target.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11913976 2002 Yeast two-hybrid screening identifies binding partners of human Tom34 that have ATPase activity and form a complex with Tom34 in the cytosol.
11913975 2002 Tom34 unlike Tom20 does not interact with the leader sequences of mitochondrial precursor proteins.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.
10101285 1999 Characterization of the novel mitochondrial protein import component, Tom34, in mammalian cells.
9660753 1998 Specific binding of tetratricopeptide repeat proteins to the C-terminal 12-kDa domain of hsp90.
9324309 1997 hTom34: a novel translocase for the import of proteins into human mitochondria.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.