Property Summary

NCBI Gene PubMed Count 29
PubMed Score 9.68
PubTator Score 10.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.600 1.7e-02
Astrocytoma, Pilocytic 1.100 1.4e-03
atypical teratoid / rhabdoid tumor 2.100 7.8e-06
cystic fibrosis 1.002 2.6e-04
ductal carcinoma in situ 1.800 1.4e-02
ependymoma 1.500 4.5e-05
glioblastoma 1.100 4.8e-03
group 4 medulloblastoma -1.500 2.0e-03
interstitial cystitis -1.500 3.4e-03
invasive ductal carcinoma 2.700 1.3e-03
lung adenocarcinoma 1.006 3.5e-05
lung cancer 1.100 1.1e-03
oligodendroglioma -2.400 4.7e-02
osteosarcoma 2.004 3.7e-04
ovarian cancer -1.900 7.2e-06
psoriasis 1.400 5.0e-04

Gene RIF (10)

AA Sequence

MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRISKNYNHKEIQ      1 - 70
LTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVKLLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVK     71 - 140
EVYLDLVKKGVQFPPSEAEAETARQETAQISSNPPTSVPTAPALSSVIAPKNSTVTLVPEQIGKLHSELD    141 - 210
MVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVELIQVNEDLNNAI    211 - 280
LGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPRMPRATLGELNTMNNQLSGLNFSLPS    281 - 350
SDVTNNLKPSLHPQMNLLALENTEIPPFAQRTSQNLTSSHAYDNFLEHSNSVFLQPVSLQTIAAAPSNQS    351 - 420
LPPLPSNHPAMTKSDLQPPNYYEVMEFDPLAPAVTTEAIYEEIDAHQHKGAQNDGD                  421 - 476
//

Text Mined References (38)

PMID Year Title