Property Summary

NCBI Gene PubMed Count 29
PubMed Score 67.60
PubTator Score 33.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Photosensitive epilepsy 8 3.674 1.8

Expression

Gene RIF (12)

PMID Text
26320582 Tom1 modulates binding of Tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism.
26007630 candidate multiple myeloma risk locus
25588840 phosphatidylinositol 5-monophosphate (PI5P) enrichment in signaling endosomes prevents endosomal maturation through the recruitment of TOM1, and point to a new function of PI5P in regulating discrete maturation steps in the endosomal system.
23023224 It was shown that that myosin VI, in concert with Tom1, plays a crucial role in autophagy. Tom1 was identified as a myosin VI binding partner on endosomes.
20083669 TOM1 is a microRNA-126 target that may have an important role in regulating innate immune responses in the cystic fibrosis lung.
18976975 Knockdown of target of myb1 (TOM1) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
17671966 A 3-marker haplotype of SNPs within TOM1 was associated with psychotic bipolar affective disorder linkage
17671966 Observational study of gene-disease association. (HuGE Navigator)
15657082 The results suggest that TOM1 is an important molecule for membrane recruitment of clathrin, and that endofin is able to exploit this recruitment at the endosome.
15047686 Tollip and Tom1 form a complex and regulate endosomal trafficking of ubiquitinated proteins
14613930 marked recruitment of TOM1 to endosomes was observed in cells overexpressing endofin or its carboxyl-terminal fragment
14563850 a Tom1-Tollip complex functions as a factor that links polyubiquitinated proteins to clathrin

AA Sequence

MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLA      1 - 70
LTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTI     71 - 140
YEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPI    141 - 210
APTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQL    211 - 280
TEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVR    281 - 350
AGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDI    351 - 420
EQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLF    421 - 490
AL                                                                        491 - 492
//

Text Mined References (40)

PMID Year Title
26320582 2015 Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism.
26007630 2015 Variants in ELL2 influencing immunoglobulin levels associate with multiple myeloma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25588840 2015 TOM1 is a PI5P effector involved in the regulation of endosomal maturation.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23023224 2012 Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20604899 2010 The emerging role of VHS domain-containing Tom1, Tom1L1 and Tom1L2 in membrane trafficking.
20150893 2010 VHS domains of ESCRT-0 cooperate in high-avidity binding to polyubiquitinated cargo.
20083669 2010 miR-126 is downregulated in cystic fibrosis airway epithelial cells and regulates TOM1 expression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19798056 2009 Participation of Tom1L1 in EGF-stimulated endocytosis of EGF receptor.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17671966 2008 Gene-based SNP mapping of a psychotic bipolar affective disorder linkage region on 22q12.3: association with HMG2L1 and TOM1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16903783 2006 Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.
16412388 2006 Recruitment of clathrin onto endosomes by the Tom1-Tollip complex.
16199040 2005 Structural basis for recognition of ubiquitinated cargo by Tom1-GAT domain.
15657082 2005 Endofin recruits clathrin to early endosomes via TOM1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15047686 2004 Tollip and Tom1 form a complex and recruit ubiquitin-conjugated proteins onto early endosomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14613930 2004 Endofin recruits TOM1 to endosomes.
14563850 2003 Tom1, a VHS domain-containing protein, interacts with tollip, ubiquitin, and clathrin.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10985773 2000 Structure of the VHS domain of human Tom1 (target of myb 1): insights into interactions with proteins and membranes.
10591208 1999 The DNA sequence of human chromosome 22.
10329004 1999 TOM1 genes map to human chromosome 22q13.1 and mouse chromosome 8C1 and encode proteins similar to the endosomal proteins HGS and STAM.