Property Summary

NCBI Gene PubMed Count 49
PubMed Score 44.05
PubTator Score 112.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Endometriosis -1.189 4.5e-02
acute myeloid leukemia 1.300 3.0e-03
adrenocortical carcinoma -1.423 1.4e-04
chronic rhinosinusitis -1.340 2.7e-02
Down syndrome 1.300 4.8e-03
ductal carcinoma in situ 1.200 1.8e-03
interstitial cystitis -1.200 1.0e-03
invasive ductal carcinoma 1.500 5.3e-03
lung cancer -1.700 7.4e-03
ovarian cancer -2.200 3.3e-07
pancreatic cancer -1.100 3.6e-04
pancreatic carcinoma -1.100 3.6e-04
Pick disease 1.200 6.7e-05
posterior fossa group A ependymoma 1.100 6.8e-04
Rheumatoid arthritis 1.400 2.2e-02
spina bifida -1.496 3.7e-02

Gene RIF (32)

AA Sequence

MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQ      1 - 70
ASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFM     71 - 140
PISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLG    141 - 210
LNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQ    211 - 280
GQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN         281 - 345
//

Text Mined References (54)

PMID Year Title