Property Summary

NCBI Gene PubMed Count 47
PubMed Score 42.55
PubTator Score 112.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Endometriosis -1.189 4.5e-02
Rheumatoid Arthritis 1.400 2.2e-02
pancreatic cancer -1.100 3.6e-04
adrenocortical carcinoma -1.423 1.4e-04
lung cancer -1.700 7.4e-03
interstitial cystitis -1.300 2.9e-05
posterior fossa group B ependymoma 1.400 2.1e-04
pancreatic carcinoma -1.100 3.6e-04
spina bifida -1.496 3.7e-02
Pick disease 1.200 6.7e-05
ductal carcinoma in situ 1.200 1.8e-03
invasive ductal carcinoma 1.500 5.3e-03
acute myeloid leukemia 1.300 3.0e-03
ovarian cancer -2.200 3.3e-07
Down syndrome 1.300 4.8e-03
chronic rhinosinusitis -1.340 2.7e-02

Synonym

Accession P50616 B2R9T0 D3DTY3 Q4KMQ0
Symbols TOB
TROB
APRO5
APRO6
PIG49
TROB1

Gene

PDB

2D5R   2Z15   5CI8   5CI9  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (30)

PMID Text
26165839 A novel role for TOB1 in mediating survival of estrogen-independent breast cancers.
25760308 Reduced TOB1 expression in gastric adenocarcinoma is associated with the extent of differentiation and the TNM stage of gastric cancer.
25446091 arsenite-induced oxidative stress inhibits deadenylation of mRNA primarily through downregulation of Tob and Pan3, both of which mediate the recruitment of deadenylases to mRNA
25043310 miR-25 promotes GC progression by directly downregulating TOB1 expression, and may be a noninvasive biomarker for the prognosis of GC patients.
23756562 TOB1 demonstrated a radioprotective function in the immortalized normal human bronchial epithelial cell line.
23589165 TOB1 modulates the radiosensitivity of lung cancer cells via the MAPK/ERK signaling pathway.
23178487 Tob is a key factor in the regulation of c-myc gene expression, which is essential for cell growth.
23066029 Cdc7 phosphorylates and interacts with Tob to inhibit the Cul4-DDB1(Cdt2)-dependent Tob degradation.
22710759 study demonstrates that the overexpression of Tob1 inhibits gastric cancer progression by activating Smad4- and inhibiting betacatenin-mediated signaling pathways
22252318 The antiproliferative and the mRNA deadenylation/decay-promoting effects of TOB1 and TOB2 proteins are linked.
22158108 TOB1 overexpression not only increased the expression of the phosphatase and tensin homolog (PTEN), an important tumor suppressor, but also regulated the downstream effectors in the PI3K/PTEN signaling pathway, including Akt, ERK1/2, etc.
21577013 Longer survival was associated with hypomethylation at specific CpG sites (e.g. GREB1, TGIF and TOB1) and hypermethylation in other genes (e.g. TMCO5, PTPRN and GUCY2C).
21533545 Silencing of HIC1 and TOB1 expression is a common occurrence in gastric cancer and may contribute to the development and progression of the disease.
21336257 Together, these results indicate that Tob mediates the recruitment of Caf1 to the target of CPEB3 and elicits deadenylation and decay of the mRNA.
20595394 Tob interactions with Caf1 and a C-terminal domain of PABPC1
19569230 Down-regulation of TOB is associated with breast cancer tumorigenesis.
19491269 positive correlation of TOB1 phosphorylation status with proliferation marker Ki67 suggests that elevated TOB1 phosphorylation might abrogate the antiproliferative effect of TOB1 in breast cancer
19453261 Observational study of gene-disease association. (HuGE Navigator)
18377426 Tob associates with the CCR4-NOT complex.
18084094 antiproliferative region of human Tob (residues 1-138) and intact hCaf1 were co-expressed in Escherichia coli, purified and successfully cocrystallized
17785442 Data show that TOB enhances mRNA deadenylation in vivo, and that interaction with PABPC1 is necessary for TOB's deadenylation-enhancing effect.
17164348 Subtractive hybridization identified Twisted gastrulation (Tsg) as one of the genes suppressed by Tob.
16997058 Reverse-transcription polymerase chain reaction confirmed increased expression of GADD45A, BTG2, PDE4B, and CEBPD and downregulation of TOB1 in skeletal muscle intradialysis.
16951159 Tob1 is a novel target for degradation by the SCF-Skp2 ubiquitin ligase in a cell line.
15676026 Tob is involved in the translational suppression of IL-2 mRNA in anergic T cells through its interaction with iPABP.
15051490 N-terminal region of TOB is a functional nuclear export signal.
14643028 Decreased expression or phosphorylation status of tob protein is associated with lung cancer
12151396 identified as a MAPK substrate
12135500 Antiproliferative proteins of the BTG/Tob family are degraded by the ubiquitin-proteasome system. the C-terminal regions are necessary and sufficient to control the stabilities of BTG1, BTG2, Tob, and Tob2 proteins.
11904957 functions as lateral signal transmitter

AA Sequence

MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQ      1 - 70
ASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFM     71 - 140
PISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLG    141 - 210
LNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQ    211 - 280
GQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN         281 - 345
//

Text Mined References (52)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26165839 2016 Acquisition of estrogen independence induces TOB1-related mechanisms supporting breast cancer cell proliferation.
25760308 2015 Clinicopathological significance of cytoplasmic transducer of ErbB2. 1 expression in gastric cancer.
25446091 2014 Arsenite inhibits mRNA deadenylation through proteolytic degradation of Tob and Pan3.
25043310 2015 MicroRNA-25 promotes gastric cancer migration, invasion and proliferation by directly targeting transducer of ERBB2, 1 and correlates with poor survival.
23756562 2013 Overexpression of TOB1 confers radioprotection to bronchial epithelial cells through the MAPK/ERK pathway.
23589165 2013 Enhanced radiosensitivity of NSCLC cells by transducer of erbB2.1 (TOB1) through modulation of the MAPK/ERK pathway.
23236473 2012 The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178487 2014 Antiproliferative protein Tob directly regulates c-myc proto-oncogene expression through cytoplasmic polyadenylation element-binding protein CPEB.
23066029 2012 Inhibition of DNA damage-induced apoptosis through Cdc7-mediated stabilization of Tob.
22710759 2012 Tob1 induces apoptosis and inhibits proliferation, migration and invasion of gastric cancer cells by activating Smad4 and inhibiting ??catenin signaling.
22252318 2012 Evidence providing new insights into TOB-promoted deadenylation and supporting a link between TOB's deadenylation-enhancing and antiproliferative activities.
22158108 2012 Suppression of human lung cancer cell proliferation and metastasis in vitro by the transducer of ErbB-2.1 (TOB1).
21577013 2011 Progression-free survival in ovarian cancer is reflected in epigenetic DNA methylation profiles.
21533545 2011 Identification of novel subregions of LOH in gastric cancer and analysis of the HIC1 and TOB1 tumor suppressor genes in these subregions.
21336257 2011 Anti-proliferative protein Tob negatively regulates CPEB3 target by recruiting Caf1 deadenylase.
20595394 2010 Quantitative characterization of Tob interactions provides the thermodynamic basis for translation termination-coupled deadenylase regulation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19569230 2009 TOB suppresses breast cancer tumorigenesis.
19491269 2009 TOB1 is regulated by EGF-dependent HER2 and EGFR signaling, is highly phosphorylated, and indicates poor prognosis in node-negative breast cancer.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19276069 2009 Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
18084094 2007 Crystallization and preliminary crystallographic analysis of the Tob-hCaf1 complex.
17785442 2007 Human TOB, an antiproliferative transcription factor, is a poly(A)-binding protein-dependent positive regulator of cytoplasmic mRNA deadenylation.
17164348 2007 Twisted gastrulation (Tsg) is regulated by Tob and enhances TGF-beta signaling in activated T lymphocytes.
16997058 2006 Hemodialysis modulates gene expression profile in skeletal muscle.
16951159 2006 Degradation of Tob1 mediated by SCFSkp2-dependent ubiquitination.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15676026 2005 Interaction of anti-proliferative protein Tob with poly(A)-binding protein and inducible poly(A)-binding protein: implication of Tob in translational control.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15235587 2004 Nuclear localization of Tob is important for regulation of its antiproliferative activity.
15051490 2004 Regulation of subcellular localization of the antiproliferative protein Tob by its nuclear export signal and bipartite nuclear localization signal sequences.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14643028 2003 Alteration of expression or phosphorylation status of tob, a novel tumor suppressor gene product, is an early event in lung cancer.
12782279 2003 Tob proteins enhance inhibitory Smad-receptor interactions to repress BMP signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12151396 2002 Identification of the Anti-proliferative protein Tob as a MAPK substrate.
12135500 2002 Antiproliferative proteins of the BTG/Tob family are degraded by the ubiquitin-proteasome system.
12050114 2002 Phosphorylation of three regulatory serines of Tob by Erk1 and Erk2 is required for Ras-mediated cell proliferation and transformation.
11694881 2001 Tob is a negative regulator of activation that is expressed in anergic and quiescent T cells.
11429045 2001 Association of ANA, a member of the antiproliferative Tob family proteins, with a Caf1 component of the CCR4 transcriptional regulatory complex.
11327693 2001 Tob-mediated cross-talk between MARCKS phosphorylation and ErbB-2 activation.
11260258 2001 A serine/threonine kinase p90rsk1 phosphorylates the anti-proliferative protein Tob.
11163184 2000 Negative regulation of BMP/Smad signaling by Tob in osteoblasts.
10602502 1999 Tob2, a novel anti-proliferative Tob/BTG1 family member, associates with a component of the CCR4 transcriptional regulatory complex capable of binding cyclin-dependent kinases.
9716660 1998 Identification and mapping of 26 human testis mRNAs containing CAG/CTG repeats.
9210596 1997 Cloning and characterization of the mouse tob gene.
8632892 1996 Tob, a novel protein that interacts with p185erbB2, is associated with anti-proliferative activity.