Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.57
PubTator Score 29.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.001 1.2e-05
non-small cell lung cancer 1.862 5.1e-15
colon cancer 2.000 1.0e-02
breast carcinoma -1.400 2.7e-02
diabetes mellitus 1.100 1.1e-03
interstitial cystitis -1.400 1.8e-04
lung adenocarcinoma 2.000 2.6e-04
psoriasis -1.100 1.4e-09
inflammatory breast cancer -2.500 1.6e-02
ovarian cancer -1.100 2.1e-04

Gene RIF (23)

PMID Text
26852686 Conclude that in colorectal cancer, Cten is upregulated by EGFR and Kras but downregulated by STAT3.
26035355 Tensin4 is up-regulated by EGF-induced ERK1/2 activity and promotes cell proliferation and migration in hepatocellular carcinoma
25439778 Cten expression mediates invasion of human lung cancer cells and is upregulated by epidermal growth factor via STAT3.
24814316 Significant correlation between MET and TNS4 expression in human colon carcinoma and ovarian carcinoma suggests TNS4 plays a critical role in MET stability in cancer.
24244691 Findings indicate that induction of Cten protein expression is a relatively early event in melanoma progression, and that Cten has the potential to serve as a prognostic marker for primary melanoma patients.
23774213 CTEN regulates EGFR protein levels through a posttranslational mechanism.
23625726 Up-regulated cten modulates cell migration induced by FGF2.
23500447 Phylogenetic analysis, expression patterns, and transcriptional regulation of human CTEN gene.
22750970 Show an oncogenic role for CTEN in pancreatic cancer through promotion of colony formation and cell motility.
21698197 conclude that, in the colon and pancreas, Cten is a downstream target of Kras and may be a mechanism through which Kras regulates of cell motility
21339732 Cten expression is of prognostic significance in colorectal carcinoma, and delineate a Cten-ILK pathway controlling cell motility and possibly promoting metastasis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20390342 CTEN (C-terminal tensin-like), a novel oncogene overexpressed in invasive breast carcinoma.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19725034 CTEN plays an important role in paclitaxel sensitivity, and CTEN expression level may be a prognostic predictive factor for prostate cancer patients.
19487278 Cten is a novel nuclear partner of beta-catenin, and has an oncogenic activity in colon cancers.
19194507 Tensins may represent a novel group of metastasis suppressors in the kidney, the loss of which leads to greater tumor cell motility and consequent metastasis.
18612693 TNS4 mRNA expression was significantly higher in gastric cancer.
17765673 Expression of CTEN correlates with high tumor grade and metastasis to lymph nodes, suggesting that CTEN may contribute to tumor invasiveness.
17643115 Data show that EGF downregulates tensin-3 expression, and concomitantly upregulates cten, a tensin family member that lacks the actin-binding domain.
17190795 These results provide a novel mechanism whereby the SH2 domain of cten-mediated focal adhesion localization of DLC-1 plays an essential role in its tumor suppression activity.
15001839 Cten/GAPDH mRNA expression was correlated with evidence of tumor progression in thymoma.
12711115 Increased cten mRNA expression was correlated with tumor progression in lung cancers

AA Sequence

MSQVMSSPLLAGGHAVSLAPCDEPRRTLHPAPSPSLPPQCSYYTTEGWGAQALMAPVPCMGPPGRLQQAP      1 - 70
QVEAKATCFLPSPGEKALGTPEDLDSYIDFSLESLNQMILELDPTFQLLPPGTGGSQAELAQSTMSMRKK     71 - 140
EESEALDIKYIEVTSARSRCHDGPQHCSSPSVTPPFGSLRSGGLLLSRDVPRETRSSSESLIFSGNQGRG    141 - 210
HQRPLPPSEGLSPRPPNSPSISIPCMGSKASSPHGLGSPLVASPRLEKRLGGLAPQRGSRISVLSASPVS    211 - 280
DVSYMFGSSQSLLHSSNSSHQSSSRSLESPANSSSSLHSLGSVSLCTRPSDFQAPRNPTLTMGQPRTPHS    281 - 350
PPLAKEHASSCPPSITNSMVDIPIVLINGCPEPGSSPPQRTPGHQNSVQPGAASPSNPCPATRSNSQTLS    351 - 420
DAPFTTCPEGPARDMQPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSYRGSFGLALKVQ    421 - 490
EVPASAQSRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQHSIMALALPCKLTIPQRELG    491 - 560
GADGASDSTDSPASCQKKSAGCHTLYLSSVSVETLTGALAVQKAISTTFERDILPTPTVVHFKVTEQGIT    561 - 630
LTDVQRKVFFRRHYPLTTLRFCGMDPEQRKWQKYCKPSWIFGFVAKSQTEPQENVCHLFAEYDMVQPASQ    631 - 700
VIGLVTALLQDAERM                                                           701 - 715
//

Text Mined References (35)

PMID Year Title
26852686 2015 Multiple pathways regulate Cten in colorectal cancer without a Tensin switch.
26035355 2015 Tensin4 is up-regulated by EGF-induced ERK1/2 activity and promotes cell proliferation and migration in hepatocellular carcinoma.
25439778 2015 C-terminal tensin-like protein mediates invasion of human lung cancer cells and is regulated by signal transducer and activator of transcription 3.
24814316 2014 Tensin-4-dependent MET stabilization is essential for survival and proliferation in carcinoma cells.
24244691 2013 C-terminal tensin-like protein is a novel prognostic marker for primary melanoma patients.
23774213 2013 CTEN prolongs signaling by EGFR through reducing its ligand-induced degradation.
23625726 2014 Up-regulated cten by FGF2 contributes to FGF2-mediated cell migration.
23500447 2013 Phylogenetic analysis, expression patterns, and transcriptional regulation of human CTEN gene.
22750970 2013 C-terminal tensin-like gene functions as an oncogene and promotes cell motility in pancreatic cancer.
21698197 2011 Cten is targeted by Kras signalling to regulate cell motility in the colon and pancreas.
21339732 2011 Cten signals through integrin-linked kinase (ILK) and may promote metastasis in colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20390342 2011 CTEN (C-terminal tensin-like), a novel oncogene overexpressed in invasive breast carcinoma of poor prognosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19725034 2010 CTEN/tensin 4 expression induces sensitivity to paclitaxel in prostate cancer.
19487278 2009 Up-regulation of C-terminal tensin-like molecule promotes the tumorigenicity of colon cancer through beta-catenin.
19194507 2009 Tensin3 is a negative regulator of cell migration and all four Tensin family members are downregulated in human kidney cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18612693 2008 Prognostic relevance of Tensin4 expression in human gastric cancer.
17765673 2007 Tensins: a new switch in cell migration.
17643115 2007 A reciprocal tensin-3-cten switch mediates EGF-driven mammary cell migration.
17190795 2007 The phosphotyrosine-independent interaction of DLC-1 and the SH2 domain of cten regulates focal adhesion localization and growth suppression activity of DLC-1.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15806167 2005 Cleavage of cten by caspase-3 during apoptosis.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15001839 Cten mRNA expression is correlated with tumor progression in thymoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12711115 2003 Cten mRNA expression was correlated with tumor progression in lung cancers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12154022 2002 Cten, a COOH-terminal tensin-like protein with prostate restricted expression, is down-regulated in prostate cancer.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.