Property Summary

NCBI Gene PubMed Count 46
PubMed Score 104.49
PubTator Score 118.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
oligodendroglioma 1.800 1.2e-03
glioblastoma -2.800 1.4e-02
ependymoma -2.100 1.3e-03
sonic hedgehog group medulloblastoma -4.200 1.0e-10
atypical teratoid / rhabdoid tumor -4.700 7.5e-11
medulloblastoma, large-cell -4.400 2.2e-08
primitive neuroectodermal tumor -2.200 4.2e-02
lung adenocarcinoma -1.100 5.7e-09
pediatric high grade glioma -2.000 1.6e-02
pilocytic astrocytoma 1.800 5.0e-06
lung carcinoma 3.400 6.3e-15
non-small cell lung carcinoma -1.200 7.6e-14

Gene RIF (16)

PMID Text
26595808 Two genes, TNR (and TNK2), were found to have genetic variations linked to familial Parkinson's Disease.
23269478 TnC and TnR play important roles in nervous and immune systems. [Review]
21456020 results show that tenascin-R expression is tightly regulated in a spatiotemporal manner during brain development, especially cortical plate formation; its pattern of expression suggests a role for tenascin-R in corticogenesis
20950796 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20202125 KIAA0510, the 3'-untranslated region of the tenascin-R gene, and tenascin-R are overexpressed in pilocytic astrocytomas
19890582 The researchers found evidence that the tenascin R gene is a potential susceptiblity or marker gene for IgA nephropathy.
19890582 Observational study of gene-disease association. (HuGE Navigator)
19573479 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18521090 Genome-wide association study of gene-disease association. (HuGE Navigator)
18415014 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17537973 An extracellular matrix molecule TNR and its associated carbohydrate human natural killer cell glycan (HNK-1) provide conditions beneficial for induction of long-term potentiation in the hippocampus.
14681222 Tenascin R is expressed and glycosylated in neurons
12927810 citation presents comparison with human gene.

AA Sequence

MGADGETVVLKNMLIGINLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKEQPVVFNHVYN      1 - 70
INVPLDNLCSSGLEASAEQEVSAEDETLAEYMGQTSDHESQVTFTHRINFPKKACPCASSAQVLQELLSR     71 - 140
IEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGNFSFESCGCICNEGWFGKNCSEPYCPLGCSS    141 - 210
RGVCVDGQCICDSEYSGDDCSELRCPTDCSSRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGT    211 - 280
CLCEEGYVGEDCGQRQCLNACSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPM    281 - 350
AVTEYVISYQPTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG    351 - 420
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEYIVNVVALKEQ    421 - 490
ARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGLVGGEGGRTTFRLQPPLSQYS    491 - 560
VQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNLRVGSRTATSLDLEWDNSEAEVQEYKVVYST    561 - 630
LAGEQYHEVLVPRGIGPTTRATLTDLVPGTEYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSET    631 - 700
SISLIWTKASGPIDHYRITFTPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISVTAERGRQQSLESTVDA    701 - 770
FTGFRPISHLHFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY    771 - 840
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRPTQVGRLDSSV    841 - 910
VPNTVTEFTITRLNPATEYEISLNSVRGREESERICTLVHTAMDNPVDLIATNITPTEALLQWKAPVGEV    911 - 980
ENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTATMYATNGPLTSGTISTNFSTLLDPPANLTAS    981 - 1050
EVTRQSALISWQPPRAEIENYVLTYKSTDGSRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTTWSSI   1051 - 1120
TSTAFTTGGRVFPHPQDCAQHLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDF   1121 - 1190
FRKWADYRVGFGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSY   1191 - 1260
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQGINWYHWKGHE   1261 - 1330
FSIPFVEMKMRPYNHRLMAGRKRQSLQF                                             1331 - 1358
//

Text Mined References (47)

PMID Year Title
26595808 2016 Whole-Exome Sequencing in Familial Parkinson Disease.
23269478 2013 Tenascins and inflammation in disorders of the nervous system.
22730557 2012 Homozygous deletion of Tenascin-R in a patient with intellectual disability.
22634605 2012 Tenascin-R: role in the central nervous system.
21956439 2012 Genome-wide association study of alcohol dependence implicates KIAA0040 on chromosome 1q.
21456020 2011 Spatiotemporal distribution of tenascin-R in the developing human cerebral cortex parallels neuronal migration.
20950796 2011 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20202125 2010 KIAA0510, the 3'-untranslated region of the tenascin-R gene, and tenascin-R are overexpressed in pilocytic astrocytomas.
19890582 2009 Parallel genotyping of 10,204 single nucleotide polymorphisms to screen for susceptible genes for IgA nephropathy.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19573479 2009 Applicability of a genetic signature for enhanced iloperidone efficacy in the treatment of schizophrenia.
19435634 2009 Three-cohort targeted gene screening reveals a non-synonymous TRKA polymorphism associated with schizophrenia.
18769035 2008 Small nuclear RNAs U11 and U12 modulate expression of TNR-CFTR mRNA in mammalian kidneys.
18696101 2008 Extracellular matrix of the central nervous system: from neglect to challenge.
18521090 2009 Association of the NPAS3 gene and five other loci with response to the antipsychotic iloperidone identified in a whole genome association study.
18415014 2009 Genetic contribution to all cancers: the first demonstration using the model of breast cancers from Poland stratified by age at diagnosis and tumour pathology.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
17537973 2007 Hippocampal metaplasticity induced by deficiency in the extracellular matrix glycoprotein tenascin-R.
16831557 2006 Early coevolution of adhesive but not antiadhesive tenascin-R ligand-receptor pairs in vertebrates: a phylogenetic study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15525355 2004 Recombinant DNA vaccine encoding multiple domains related to inhibition of neurite outgrowth: a potential strategy for axonal regeneration.
14681222 2004 Neuronal-specific synthesis and glycosylation of tenascin-R.
12927810 2003 Structure of the murine tenascin-R gene and functional characterisation of the promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11246000 2001 The structure and function of tenascins in the nervous system.
11038354 2001 The proteoglycans aggrecan and Versican form networks with fibulin-2 through their lectin domain binding.
10842355 2000 The tenascin family of ECM glycoproteins: structure, function, and regulation during embryonic development and tissue remodeling.
10773191 2000 Involvement of chondroitin sulfates on brain-derived tenascin-R in carbohydrate-dependent interactions with fibronectin and tenascin-C.
10417662 1999 Tenascin-R and C in multiple sclerosis lesions: relevance to extracellular matrix remodelling.
10406848 1999 Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans.
9722619 1998 Dissection of complex molecular interactions of neurofascin with axonin-1, F11, and tenascin-R, which promote attachment and neurite formation of tectal cells.
9539107 1998 Structure of 5' region of human tenascin-R gene and characterization of its promoter.
9403076 1997 Radiation hybrid mapping of the genes for tenascin-R (TNR), phosducin (PDC), laminin C1 (LAMC1), and TAX in 1q25-q32.
9371410 1997 Assignment of the tenascin-R gene (Tnr) to mouse chromosome 4 band E2 by fluorescence in situ hybridization; refinement of the human TNR location to chromosome 1q24.
9335257 1997 Signaling events following the interaction of the neuronal adhesion molecule F3 with the N-terminal domain of tenascin-R.
9294172 1997 The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.
9081628 1996 Distinct effects of recombinant tenascin-R domains in neuronal cell functions and identification of the domain interacting with the neuronal recognition molecule F3/11.
8940128 1996 The human tenascin-R gene.
8626505 1996 Human tenascin-R. Complete primary structure, pre-mRNA alternative splicing and gene localization on chromosome 1q23-q24.
7694605 1993 Tenascin-C, tenascin-R and tenascin-X: a family of talented proteins in search of functions.
7530148 1994 Evolution of the tenascin family--implications for function of the C-terminal fibrinogen-like domain.