Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.79
PubTator Score 9.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 4.5e-03
atypical teratoid / rhabdoid tumor -1.400 1.3e-04
glioblastoma -1.600 1.3e-05
group 4 medulloblastoma -1.300 1.4e-03
medulloblastoma, large-cell -1.600 9.8e-05
non primary Sjogren syndrome sicca 1.100 1.7e-02
osteosarcoma 1.552 1.3e-04
ovarian cancer -1.100 9.0e-05
pancreatic ductal adenocarcinoma liver m... 1.195 1.8e-02
psoriasis -1.400 2.2e-04

Gene RIF (7)

AA Sequence

MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIFVLTRLKSEDEPTRSLSGLIL      1 - 70
KNNVKAHYQSFPPPVADFIKQECLNNIGDASSLIRATIGILITTIASKGELQMWPELLPQLCNLLNSEDY     71 - 140
NTCEGAFGALQKICEDSSELLDSDALNRPLNIMIPKFLQFFKHCSPKIRSHAIACVNQFIMDRAQALMDN    141 - 210
IDTFIEHLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQYMLQRTQDHDENVALEACEFWLT    211 - 280
LAEQPICKEVLASHLVQLIPILVNGMKYSEIDIILLKGDVEEDEAVPDSEQDIKPRFHKSRTVTLPHEAE    281 - 350
RPDGSEDAEDDDDDDALSDWNLRKCSAAALDVLANVFREELLPHLLPLLKGLLFHPEWVVKESGILVLGA    351 - 420
IAEGCMQGMVPYLPELIPHLIQCLSDKKALVRSIACWTLSRYAHWVVSQPPDMHLKPLMTELLKRILDGN    421 - 490
KRVQEAACSAFATLEEEACTELVPYLSYILDTLVFAFGKYQHKNLLILYDAIGTLADSVGHHLNQPEYIQ    491 - 560
KLMPPLIQKWNELKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVTLVQKTLAQAMMYTQHPEQY    561 - 630
EAPDKDFMIVALDLLSGLAEGLGGHVEQLVARSNIMTLLFQCMQDSMPEVRQSSFALLGDLTKACFIHVK    631 - 700
PCIAEFMPILGTNLNPEFISVCNNATWAIGEICMQMGAEMQPYVQMVLNNLVEIINRPNTPKTLLENTGR    701 - 770
LTSPSAIPAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICMMIGVNPGGVVQDFI    771 - 840
FFCDAVASWVSPKDDLRDMFYKILHGFKDQVGEDNWQQFSEQFPPLLKERLAAFYGV                 841 - 897
//

Text Mined References (22)

PMID Year Title