Property Summary

NCBI Gene PubMed Count 80
PubMed Score 43.24
PubTator Score 59.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Frontotemporal dementia 47 3.917 2.0
Amyotrophic Lateral Sclerosis 432 3.56 1.8

Expression

  Differential Expression (39)

Disease log2 FC p
Rheumatoid Arthritis 1.300 2.9e-02
hepatocellular carcinoma 1.100 1.3e-04
pancreatic cancer 1.100 5.6e-03
Waldenstrons macroglobulinemia 1.147 9.4e-03
Multiple myeloma 1.533 1.1e-03
astrocytoma 1.600 7.5e-03
oligodendroglioma 1.300 4.7e-18
permanent atrial fibrillation -1.100 2.4e-02
esophageal adenocarcinoma 1.500 2.5e-02
psoriasis -1.300 4.0e-04
glioblastoma 2.200 5.7e-13
osteosarcoma -1.466 2.9e-08
ependymoma 1.700 3.7e-11
group 3 medulloblastoma 2.600 4.0e-07
atypical teratoid/rhabdoid tumor 2.100 8.5e-09
medulloblastoma, large-cell 2.500 3.7e-06
primitive neuroectodermal tumor 2.200 3.0e-07
Crohn's disease -1.053 3.4e-02
ulcerative colitis -1.458 1.8e-02
juvenile dermatomyositis 1.291 2.3e-08
acute quadriplegic myopathy 1.111 2.1e-03
Atopic dermatitis 1.200 9.3e-05
tuberculosis and treatment for 3 months -1.600 4.2e-05
pancreatic ductal adenocarcinoma liver m... 2.651 3.9e-03
non-small cell lung cancer 1.789 2.2e-26
intraductal papillary-mucinous adenoma (... 1.100 5.5e-04
intraductal papillary-mucinous carcinoma... 1.300 4.8e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.5e-02
lung cancer 1.200 2.6e-04
pediatric high grade glioma 2.200 5.9e-11
pilocytic astrocytoma 1.700 2.8e-08
non primary Sjogren syndrome sicca -1.500 2.4e-02
pancreatic carcinoma 1.100 5.6e-03
subependymal giant cell astrocytoma 1.629 3.1e-02
Alzheimer's disease 1.200 1.5e-02
Pick disease 2.000 6.6e-08
invasive ductal carcinoma 1.100 3.9e-03
ovarian cancer -2.300 9.1e-11
dermatomyositis 1.600 2.0e-04

Gene RIF (60)

PMID Text
26056081 FGF2 nuclear translocation is regulated by Karyopherin-beta2 and Ran GTPase in human glioblastoma cells
26052940 Kapbeta2 interacts with ULK2 through ULK2's putative PY-NLS motif, and facilitates transport from the cytoplasm to the nucleus, depending on its Ser1027 residue phosphorylation by PKA, thereby reducing autophagic activity.
24780099 Studies indicate potential roles of Tranportin-1 and Transportin-2 beyond protein nuclear import.
24753571 ADAR1 carries a unique nuclear localization signal (NLS) that overlaps one of its double-stranded RNA-binding domains (dsRBDs). This dsRBD-NLS is recognized by nuclear import receptor transportin 1 (also called karyopherin-beta2) in an RNA-sensitive manner.
24200467 Data suggest the C-terminal nuclear localization domain (QYP) is critical for RAM (RNMT-activating mini protein) to enter the cell nucleus where RAM activates RNMT resulting in mRNA cap methylation; TNPO1/TNPO2 mediate RAM nuclear entry.
23535894 Crystal structure of human Karyopherin beta2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2
23333309 Disulfide formation with transportin-1 is required for nuclear localization and the activation of FOXO4 induced by reactive oxygen species.
23266416 In case of L7, importin beta2 or importin beta3 are preferentially used by clusters with a high import efficiency.
23056579 The crystal structure of the FUS-NLS/Trn1 complex shows extensive contacts between the two proteins and a unique alpha-helical structure in the FUS-NLS.
23012356 Identification of a karyopherin beta1/beta2 proline-tyrosine nuclear localization signal in huntingtin protein.
22968170 arginine methylation impairs TRN dependent nuclear import of FUS, by decreasing binding of TRN to a novel TRN-binding motif next to the proline-tyrosine nuclear localization signal of FUS.
22934812 C-terminal FUS mutations prevent TNPO 1 binding to the NLS, inhibiting nuclear import and promoting cytoplasmic aggregation. The presence of TNPO 1 in wild-type FUS aggregates in frontotemporal lobar degeneration-FUS distinguishes it from ALS.
22842875 These data imply a specific dysfunction in the interaction between Trn1 and FET proteins in the inclusion body formation in FTLD-FUS.
22783232 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
22509482 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
22174317 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
21808065 Transportin binding might delay methylation of PABPN1 until after nuclear import.
21489275 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
21326825 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
21285245 Data demonstrate that Importin beta2 is necessary for localization of retinitis pigmentosa 2 (RP2) to the primary cilium, and identify two distinct binding sites of RP2, which interact independently with Importin beta2.
20606625 Nuclear import of fused in sarcoma (FUS) is dependent on Transportin, and interference with this transport pathway leads to cytoplasmic redistribution and recruitment of fused in sarcoma (FUS) into stress granules.
20308327 Results suggest that hnRNP H and F are nuclear shuttling proteins whose posttranslational modifications may alter interaction with transportin 1, nuclear localization, and hence function.
20015032 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
19641022 The interplay of the two negative regulators, transportin and importin beta, along with the positive regulator RanGTP, allows precise choreography of multiple cell cycle assembly events.
19549784 Ran in complex with importin-beta has a higher affinity for GTP. This feature is responsible for the generation of Ran-GTP from Ran-GDP by importin-beta.
19275582 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
19124606 we identify transportin-1 as the import receptor for ADAR1.
19057841 Data suggest that increased MIP-1alpha/beta production enhances multiple myeloma cell binding to stromal cells by VLA-4-VCAM-1 adhesion, forming a "vicious cycle" between MM cell adhesion to stromal cells and MIP-1 production via VLA-4-VCAM-1 interaction.
18846510 TRN1-binding to CCR2 promotes its nuclear translocation in a TRN1-dependent manner.
18445273 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
17997969 the 3.0 A crystal structure of unliganded Kap beta2, which consists of a superhelix of 20 HEAT repeats
17936704 Results describe four crystal structures of human transoprtin 1 in a substrate-free form as well as in the complex with three nuclear localization signals.
17586317 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
15507604 HPV16 L2 interacts via its NLSs with a network of karyopherins and can enter the nucleus via several import pathways mediated by Kapalpha(2)beta(1) heterodimers, Kapbeta(2), and Kapbeta(3).
12620808 1 major capsid protein of human papillomavirus type 11 interacts with Kap beta2 nuclear import receptor
12614157 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
12551970 nuclear import of the HPV16 E6 oncoprotein in digitonin-permeabilized HeLa cells could be mediated by Kap beta2
12414950 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
12368302 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
11389849 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
11278458 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
11035935 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
10888652 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
10860744 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
10772949 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
10525473 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
10366569 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9891055 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9817747 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9621063 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9582382 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9562972 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9463369 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9436978 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9430704 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9405152 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9366553 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
9275210 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
8105392 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta
1631159 HIV-1 Vpr causes increased levels of CyclinB1, Plk1, and Cdk1 in a complex with the nuclear transport and spindle assembly protein, importin beta

AA Sequence

MVWDRQTKMEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDE      1 - 70
PTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPK     71 - 140
LCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFI    141 - 210
ISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENV    211 - 280
ALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRS    281 - 350
RTVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWV    351 - 420
VKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLM    421 - 490
TELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSV    491 - 560
GHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQ    561 - 630
AMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLG    631 - 700
DLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPN    701 - 770
TPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDF    771 - 840
IFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV                841 - 898
//

Text Mined References (86)

PMID Year Title
26056081 2015 Nuclear translocation of fibroblast growth factor-2 (FGF2) is regulated by Karyopherin-?2 and Ran GTPase in human glioblastoma cells.
26052940 2015 ULK2 Ser 1027 Phosphorylation by PKA Regulates Its Nuclear Localization Occurring through Karyopherin Beta 2 Recognition of a PY-NLS Motif.
24780099 2014 Transportin-1 and Transportin-2: protein nuclear import and beyond.
24753571 2014 A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.
24200467 2014 RAM function is dependent on Kap?2-mediated nuclear entry.
23535894 2013 Crystal structure of human Karyopherin ?2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
23333309 2013 Redox-dependent control of FOXO/DAF-16 by transportin-1.
23266416 2013 The quantitative assessment of the role played by basic amino acid clusters in the nuclear uptake of human ribosomal protein L7.
23056579 2012 FUS-NLS/Transportin 1 complex structure provides insights into the nuclear targeting mechanism of FUS and the implications in ALS.
23012356 2012 Identification of a karyopherin ?1/?2 proline-tyrosine nuclear localization signal in huntingtin protein.
22968170 2012 Arginine methylation next to the PY-NLS modulates Transportin binding and nuclear import of FUS.
22934812 2013 Transportin 1 colocalization with Fused in Sarcoma (FUS) inclusions is not characteristic for amyotrophic lateral sclerosis-FUS confirming disrupted nuclear import of mutant FUS and distinguishing it from frontotemporal lobar degeneration with FUS inclusions.
22842875 2012 Transportin 1 accumulates specifically with FET proteins but no other transportin cargos in FTLD-FUS and is absent in FUS inclusions in ALS with FUS mutations.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21808065 2011 Arginine methylation of the nuclear poly(a) binding protein weakens the interaction with its nuclear import receptor, transportin.
21285245 2011 Localization of retinitis pigmentosa 2 to cilia is regulated by Importin beta2.
21269460 2011 Initial characterization of the human central proteome.
20606625 2010 ALS-associated fused in sarcoma (FUS) mutations disrupt Transportin-mediated nuclear import.
20308327 2010 A glycine-rich domain of hnRNP H/F promotes nucleocytoplasmic shuttling and nuclear import through an interaction with transportin 1.
19641022 2009 Transportin regulates major mitotic assembly events: from spindle to nuclear pore assembly.
19549784 2009 Importin-beta is a GDP-to-GTP exchange factor of Ran: implications for the mechanism of nuclear import.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19386897 2009 Characterization of Snail nuclear import pathways as representatives of C2H2 zinc finger transcription factors.
19124606 2009 RNA-regulated interaction of transportin-1 and exportin-5 with the double-stranded RNA-binding domain regulates nucleocytoplasmic shuttling of ADAR1.
19057841 2009 Vicious cycle between myeloma cell binding to bone marrow stromal cells via VLA-4-VCAM-1 adhesion and macrophage inflammatory protein-1alpha and MIP-1beta production.
18846510 2008 Chemokine receptor CCR2 undergoes transportin1-dependent nuclear translocation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
17997969 2007 Conformational heterogeneity of karyopherin beta2 is segmental.
17936704 2007 Structural basis for substrate recognition and dissociation by human transportin 1.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16704975 2006 Multiple importins function as nuclear transport receptors for the Rev protein of human immunodeficiency virus type 1.
15507604 2004 The l2 minor capsid protein of human papillomavirus type 16 interacts with a network of nuclear import receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342649 2004 AMP-activated protein kinase-regulated phosphorylation and acetylation of importin alpha1: involvement in the nuclear import of RNA-binding protein HuR.
15037768 2004 Transportins 1 and 2 are redundant nuclear import factors for hnRNP A1 and HuR.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12905863 2001 [Determination of the binding site of testis-specific nucleoporin BS-63 to transportin (karopherin beta 2) and the proof of their combination in vitro].
12620808 2003 The L1 major capsid protein of human papillomavirus type 11 interacts with Kap beta2 and Kap beta3 nuclear import receptors.
12614157 2003 Inhibition of nuclear import mediated by the Rev-arginine rich motif by RNA molecules.
12551970 2003 Nuclear entry of high-risk human papillomavirus type 16 E6 oncoprotein occurs via several pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414950 2002 Reassessment of the roles of integrase and the central DNA flap in human immunodeficiency virus type 1 nuclear import.
12368302 2002 Nuclear localization of human immunodeficiency virus type 1 preintegration complexes (PICs): V165A and R166A are pleiotropic integrase mutants primarily defective for integration, not PIC nuclear import.
11824786 2001 Core histones and linker histones are imported into the nucleus by different pathways.
11774384 2002 Characterization and potential function of a novel testis-specific nucleoporin BS-63.
11682607 2001 Signal recognition particle protein 19 is imported into the nucleus by importin 8 (RanBP8) and transportin.
11389849 2001 HIV-1 infection requires a functional integrase NLS.
11278458 2001 Characterization of the nuclear import pathway for HIV-1 integrase.
11035935 2000 Cellular distribution and karyophilic properties of matrix, integrase, and Vpr proteins from the human and simian immunodeficiency viruses.
11024021 2000 Identification of two novel RanGTP-binding proteins belonging to the importin beta superfamily.
10888652 2000 The karyophilic properties of human immunodeficiency virus type 1 integrase are not required for nuclear import of proviral DNA.
10875935 2000 The nucleoporin Nup98 is a site for GDP/GTP exchange on ran and termination of karyopherin beta 2-mediated nuclear import.
10860744 2000 Two nuclear localization signals in the HIV-1 matrix protein regulate nuclear import of the HIV-1 pre-integration complex.
10772949 2000 Intranuclear binding by the HIV-1 regulatory protein VPR is dependent on cytosolic factors.
10688363 2000 Deciphering the cellular pathway for transport of poly(A)-binding protein II.
10668806 2000 The C-terminal domain of TAP interacts with the nuclear pore complex and promotes export of specific CTE-bearing RNA substrates.
10525473 1999 HIV-1 nuclear import: in search of a leader.
10366569 1999 Nuclear localization of human immunodeficiency virus type 1 integrase expressed as a fusion protein with green fluorescent protein.
10353245 1999 Structure of the nuclear transport complex karyopherin-beta2-Ran x GppNHp.
10202161 1999 Nup153 is an M9-containing mobile nucleoporin with a novel Ran-binding domain.
9891055 1999 The arginine-rich domains present in human immunodeficiency virus type 1 Tat and Rev function as direct importin beta-dependent nuclear localization signals.
9817747 1998 Characterization of HIV-1 vpr nuclear import: analysis of signals and pathways.
9687515 1998 Importin beta, transportin, RanBP5 and RanBP7 mediate nuclear import of ribosomal proteins in mammalian cells.
9632798 1998 Functional conservation of the transportin nuclear import pathway in divergent organisms.
9621063 1998 Interaction of the human immunodeficiency virus type 1 Vpr protein with the nuclear pore complex.
9582382 1998 Viral protein R regulates docking of the HIV-1 preintegration complex to the nuclear pore complex.
9562972 1998 HIV-1 nuclear import: matrix protein is back on center stage, this time together with Vpr.
9524220 1998 Molecular cloning of the cDNA encoding A + U-rich element RNA binding factor.
9463369 1998 Viral protein R regulates nuclear import of the HIV-1 pre-integration complex.
9436978 1998 HIV-1 Vpr interacts with the nuclear transport pathway to promote macrophage infection.
9430704 1998 The HIV-1 Tat nuclear localization sequence confers novel nuclear import properties.
9405152 1997 Interactions between HIV Rev and nuclear import and export factors: the Rev nuclear localisation signal mediates specific binding to human importin-beta.
9366553 1997 HIV-1 nuclear import: in search of a leader.
9298975 1997 Transportin-mediated nuclear import of heterogeneous nuclear RNP proteins.
9275210 1997 HIV-1 infection of nondividing cells through the recognition of integrase by the importin/karyopherin pathway.
9202393 1997 Nuclear import of hnRNP A1 is mediated by a novel cellular cofactor related to karyopherin-beta.
9144189 1997 Karyopherin beta2 mediates nuclear import of a mRNA binding protein.
8986607 1996 Transportin: nuclear transport receptor of a novel nuclear protein import pathway.
8808633 1996 A novel receptor-mediated nuclear protein import pathway.
8521471 1995 A nuclear export signal in hnRNP A1: a signal-mediated, temperature-dependent nuclear protein export pathway.
8105392 1993 A nuclear localization signal within HIV-1 matrix protein that governs infection of non-dividing cells.
7604027 1995 Mammalian karyopherin alpha 1 beta and alpha 2 beta heterodimers: alpha 1 or alpha 2 subunit binds nuclear localization signal and beta subunit interacts with peptide repeat-containing nucleoporins.
1631159 1992 Active nuclear import of human immunodeficiency virus type 1 preintegration complexes.