Property Summary

NCBI Gene PubMed Count 23
PubMed Score 57.86
PubTator Score 150.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.6e-02

 GO Function (1)

Gene RIF (10)

PMID Text
26098692 Among Systemic lupus erythematosus patients, 63.6% and 45.5% of those with lupus nephritis were positive for anti-RRP8 and anti-TNP1 antibodies, compared with 12.5% and 9.4% of Systemic lupus erythematosus patients without nephritis, respectively.
20522125 frequency of the haplotype GCG (H3) was increased in azoospermic men compared with fertile men. expression analysis of the TNP1 gene in obstructive azoospermic men showed that haplotypes of the TNP1 gene do not affect its expression level.
20522125 Observational study of gene-disease association. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
18727729 The presence of transition proteins (TP1 and/or TP2) in spermatids in semen indicates inhibition in the differentiation pathway from round spermatids to spermatozoa in infertile men.
18292840 The TNP1 contributes not only to successful fertilization, but may has an important impact in development of preimplantation embryos.
17852044 We found significantly lower levels of HILS1, TNP1, and TNP2 transcripts in spermatozoa from asthenozoospermic men compared to normozoospermic men.
16989827 Observational study of gene-disease association. (HuGE Navigator)
16291974 Observational study of gene-disease association. (HuGE Navigator)
16291974 a deletion of 15 nucleotides encompassing the recognition site for the cAMP response element transcription factor was found in the 5'-promoter region of the TNP1 gene in infertile men; this deletion reduces TNP1 expression and may cause infertility

AA Sequence

MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL                     1 - 55
//

Text Mined References (23)

PMID Year Title
26098692 2015 Novel Autoantigens Associated with Lupus Nephritis.
25416956 2014 A proteome-scale map of the human interactome network.
21931568 2011 Genome-wide association study identifies four loci associated with eruption of permanent teeth.
20522125 2011 The TNP1 haplotype - GCG is associated with azoospermia.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
18727729 2008 Spermiogenesis defects in human: detection of transition proteins in semen from some infertile men.
18292840 2007 Association between fertilin beta, protamines 1 and 2 and spermatid-specific linker histone H1-like protein mRNA levels, fertilization ability of human spermatozoa, and quality of preimplantation embryos.
17852044 Quantitative assessment of transition proteins 1, 2 spermatid-specific linker histone H1-like protein transcripts in spermatozoa from normozoospermic and asthenozoospermic men.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16989827 2006 Identification of novel polymorphisms in the nuclear protein genes and their relationship with human sperm protamine deficiency and severe male infertility.
16291974 Single-nucleotide polymorphisms and mutation analyses of the TNP1 and TNP2 genes of fertile and infertile human male populations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12743712 2003 Roles of transition nuclear proteins in spermiogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11315969 1998 Electron microscopic in situ hybridization study of simultaneous expression of TNP1 and PRM1 genes in human spermatids.
10781074 2000 Abnormal spermatogenesis and reduced fertility in transition nuclear protein 1-deficient mice.
9809674 1998 Expression of mRNA and protein of nucleoproteins during human spermiogenesis.
8019440 1994 The amino acid sequence and phosphorylation sites of a boar transition protein 1.
3412903 1988 The nucleotide sequence of human transition protein 1 cDNA.
3382664 1988 Nucleotide sequence of a cDNA clone encoding mouse transition protein 1.
2250010 1990 Interaction of spermatid-specific protein TP2 with nucleic acids, in vitro. A comparative study with TP1.
2249851 1990 Nucleotide sequence of the gene for human transition protein 1 and its chromosomal localization on chromosome 2.
2040274 1991 Nuclear transition protein 1 from ram elongating spermatids. Mass spectrometric characterization, primary structure and phosphorylation sites of two variants.