Property Summary

NCBI Gene PubMed Count 55
PubMed Score 2740.64
PubTator Score 542.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.900 4.2e-03
ependymoma -1.900 8.0e-03
oligodendroglioma -1.600 1.0e-02
psoriasis -1.600 5.3e-34
osteosarcoma 1.321 1.7e-05
medulloblastoma -2.000 1.7e-06
cystic fibrosis -1.168 1.6e-05
glioblastoma -1.500 9.3e-04
primitive neuroectodermal tumor -1.700 5.3e-03
acute quadriplegic myopathy -1.319 2.7e-05
non-small cell lung cancer 1.320 4.2e-09
lung cancer -1.500 8.7e-04
pediatric high grade glioma -1.400 2.1e-04
pilocytic astrocytoma -1.400 1.3e-05
Breast cancer 2.000 6.9e-05
invasive ductal carcinoma 2.000 3.7e-02
ovarian cancer 2.100 2.6e-04

 MGI Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (25)

PMID Text
26774798 Three homologous genes have evolved in vertebrates to encode three muscle type-specific TnT isoforms: TNNT1 for slow skeletal muscle TnT, TNNT2 for cardiac muscle TnT, and TNNT3 for fast skeletal muscle TnT.
26296490 Nemaline body myopathy Palestinian patients were found to have a novel mutation in troponin T1.
24781421 Biopsy-proven acute and viral myocarditis is associated with elevated concentrations of hs-TnT.
24625749 troponin T and creatinine kinase isoenzyme (CK-MB) have roles in combined renal and myocardial injuries in asphyxiated infants
24020864 Troponin T1 blood levels had a positive association with increased risk for hypertrophic cardiomyopathy.
23244308 TNNT1 DNA methylation levels were positively correlated with mean HDL particle size, HDL-phospholipid, HDL-apolipoprotein AI, HDL-C and TNNT1 expression levels.
22977240 Human slow skeletal troponin T (HSSTnT) isoforms, despite being homologues of cardiac TnT may display distinct functional properties in muscle regulation.
22448368 analysis of parameters of oxygen-dependent metabolism of neutrophils by NBT test and levels of vWF antigen in the serum can be used for predicting the risk of unfavorable outcome in patients with ACS and normal troponin T
22239123 baseline cTnT levels are higher in patients with MPI evidence of reversible myocardial ischaemia than those without reversible ischaemia
21784424 carotid-femoral pulse wave and office pulse pressure are associated with minimally elevated hsTnT levels in the elderly
21729325 In heart failure patients with normal ejection fraction, highly sensitive troponin T and heart fatty acid binding protein are elevated independent of coronary artery disease.
21683708 the hypertrophic phenotype associated with the TnT mutations can be characterized by a significant increase in disorder of rigor cross-bridges.
21448949 Cardiac troponin T and creatine kinase have roles in infarct size and left ventricular function after acute myocardial infarction
21111984 Elevated serum troponin T levels are associated with different conditions related to the severity of hypertrophic cardiomyopathy.
20889975 analysis of order and disorder in troponin C, T and I
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20380359 Among athletees, faster runners demonstrate significantly stronger cardoac TnT releases and inflammation signs.
20038417 troponin-T mutations were responsible for 3% of the hypertrophic cardiomyopathy cases in our study population
19916752 The occurrence of myocardial infarction is associated with elevated troponin T levels.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19690080 TNT is a biochemical marker of susceptibility to hypoxia in infants of type 1 diabetic mothers.
19541721 Troponin T may have a role in pulmonary embolism progeresion to death
19326042 slow TnT was encoded by two different transcripts in significantly different ratios in myotonic dystrophy type 1 and myotonic dystrophy type 2 muscles.
18579801 Report adaptation by alternative RNA splicing of slow troponin T isoforms in type 1 but not type 2 Charcot-Marie-Tooth disease.
15665378 Data suggest that inefficient incorporation into myofilament is responsible for the instability of mutant slow troponin T in Amish nemaline myopathy.

AA Sequence

MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKR      1 - 70
MEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEA     71 - 140
KKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLRARSAWL    141 - 210
PPSQPSCPAREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK      211 - 278
//

Text Mined References (54)

PMID Year Title
26774798 2016 TNNT1, TNNT2, and TNNT3: Isoform genes, regulation, and structure-function relationships.
26296490 2016 Nemaline body myopathy caused by a novel mutation in troponin T1 (TNNT1).
25416956 2014 A proteome-scale map of the human interactome network.
24781421 2014 Diagnostic and prognostic validity of different biomarkers in patients with suspected myocarditis.
24625749 2014 The diagnostic value of both troponin T and creatinine kinase isoenzyme (CK-MB) in detecting combined renal and myocardial injuries in asphyxiated infants.
24020864 2013 Use of a highly-sensitive cardiac troponin I assay in a screening population for hypertrophic cardiomyopathy: a case-referent study.
23244308 2012 Epigenome-wide analysis in familial hypercholesterolemia identified new loci associated with high-density lipoprotein cholesterol concentration.
22977240 2012 The functional properties of human slow skeletal troponin T isoforms in cardiac muscle regulation.
22448368 2011 Markers of inflammation and intracellular metabolism of neutrophils in patients with acute coronary syndrome and normal troponin T levels.
22239123 2012 Cardiac troponin T levels and exercise stress testing in patients with suspected coronary artery disease: the Akershus Cardiac Examination (ACE) 1 study.
21784424 2011 Arterial stiffness is associated with minimally elevated high-sensitivity cardiac, troponin T levels in a community-dwelling population.
21729325 2011 High sensitive troponin T and heart fatty acid binding protein: novel biomarker in heart failure with normal ejection fraction? A cross-sectional study.
21683708 2011 Myosin cross-bridges do not form precise rigor bonds in hypertrophic heart muscle carrying troponin T mutations.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21448949 2011 Cardiac troponin T and creatine kinase predict mid-term infarct size and left ventricular function after acute myocardial infarction: a cardiac MR study.
21111984 2010 Serum levels of high-sensitivity troponin T: a novel marker for cardiac remodeling in hypertrophic cardiomyopathy.
20889975 2010 Low temperature dynamic mapping reveals unexpected order and disorder in troponin.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20380359 2010 Cardiac troponin T release and inflammation demonstrated in marathon runners.
20038417 2009 Hypertrophic cardiomyopathy. A study of the troponin-T gene in 127 Spanish families.
19916752 2010 Association of troponin T and altered lipid profile in patients admitted with acute myocardial infarction.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690080 2009 Troponin T and pro-B-type natriuretic Peptide in fetuses of type 1 diabetic mothers.
19541721 2009 Troponin T predicts in-hospital and 1-year mortality in patients with pulmonary embolism.
19326042 2009 Comparative transcriptional and biochemical studies in muscle of myotonic dystrophies (DM1 and DM2).
18579801 2008 Adaptation by alternative RNA splicing of slow troponin T isoforms in type 1 but not type 2 Charcot-Marie-Tooth disease.
18032382 2008 A troponin T mutation that causes infantile restrictive cardiomyopathy increases Ca2+ sensitivity of force development and impairs the inhibitory properties of troponin.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15967462 2005 MURF-1 and MURF-2 target a specific subset of myofibrillar proteins redundantly: towards understanding MURF-dependent muscle ubiquitination.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15665378 2005 Cellular fate of truncated slow skeletal muscle troponin T produced by Glu180 nonsense mutation in amish nemaline myopathy.
15495263 2004 Congenital myopathies: diseases of the actin cytoskeleton.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11904166 2002 The interaction of the bisphosphorylated N-terminal arm of cardiac troponin I-A 31P-NMR study.
10952871 2000 A novel nemaline myopathy in the Amish caused by a mutation in troponin T1.
10601315 1999 A novel interaction of cGMP-dependent protein kinase I with troponin T.
10529204 1999 Altered regulatory function of two familial hypertrophic cardiomyopathy troponin T mutants.
10451243 1999 Release of cardiac troponin in acute coronary syndromes: ischemia or necrosis?
10191089 1999 Close physical linkage of human troponin genes: organization, sequence, and expression of the locus encoding cardiac troponin I and slow skeletal troponin T.
9724539 1998 A recombinant monocysteine mutant (Ser to Cys-155) of fast skeletal troponin T: identification by cross-linking of a domain involved in a physiologically relevant interaction with troponins C and I.
9448267 1998 Identification and mutagenesis of a highly conserved domain in troponin T responsible for troponin I binding: potential role for coiled coil interaction.
8987992 1996 Interaction of deletion mutants of troponins I and T: COOH-terminal truncation of troponin T abolishes troponin I binding and reduces Ca2+ sensitivity of the reconstituted regulatory system.
8681137 1996 Identification of 4370 expressed sequence tags from a 3'-end-specific cDNA library of human skeletal muscle by DNA sequencing and filter hybridization.
8403232 1993 Isolation and cloning by a polymerase chain reaction of a genomic DNA fragment of the human slow skeletal troponin (TNNT1) gene.
8135831 1994 A new human slow skeletal troponin T (TnTs) mRNA isoform derived from alternative splicing of a single gene.
6822572 1983 Effects of troponin-I plus-C on the binding of troponin-T and its fragments to alpha-tropomyosin. Ca2+ sensitivity and cooperativity.
3611073 1987 The effects of troponin T fragments T1 and T2 on the binding of nonpolymerizable tropomyosin to F-actin in the presence and absence of troponin I and troponin C.
2824479 1987 Alternative splicing generates variants in important functional domains of human slow skeletal troponin T.
2687327 1989 Molecular basis of cardiac performance. Plasticity of the myocardium generated through protein isoform switches.
1706783 1990 Isolation and localization of a slow troponin (TnT) gene on chromosome 19 by subtraction hybridization of a cDNA muscle library using myotonic dystrophy muscle cDNA.
1551677 1992 Assignment of the slow troponin T (TNNT1) gene to chromosome 19 using polymerase chain reaction.
1505979 1992 Assignment of the human slow skeletal troponin T gene to 19q13.4 using somatic cell hybrids and fluorescence in situ hybridization analysis.
1473264 1992 Polymerase chain reaction in the detection of mRNA transcripts from the slow skeletal troponin T (TNNT1) gene in myotonic dystrophy and normal muscle.