Property Summary

NCBI Gene PubMed Count 300
PubMed Score 3485.56
PubTator Score 1640.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
group 3 medulloblastoma 4104 2.1e-02
facioscapulohumeral dystrophy 288 3.0e-02
Disease Target Count Z-score Confidence
Hypertrophic Cardiomyopathy 117 0.0 5.0

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 1.800 3.0e-02
group 3 medulloblastoma -1.100 2.1e-02

Protein-protein Interaction (1)

Gene RIF (260)

AA Sequence

MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRG      1 - 70
EKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFK     71 - 140
RPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES    141 - 210
//

Text Mined References (302)

PMID Year Title