Property Summary

NCBI Gene PubMed Count 273
PubMed Score 3223.95
PubTator Score 1640.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.100 2.1e-02
facioscapulohumeral dystrophy 1.800 3.0e-02

Protein-protein Interaction (8)

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
493008 screening 801 / 0 / 334660 Fluorescence-based biochemical primary high throughput screening assay to identify activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
493018 summary 0 / 0 / 0 Summary of the probe development efforts to identify activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
493244 screening 390 / 0 / 335070 Fluorescence-based biochemical primary high throughput screening assay to identify inhibitors of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504337 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504383 screening 1166 / 0 / 1301 Fluorescence-based biochemical high throughput confirmation assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504635 screening 30 / 0 / 328 Fluorescence-based biochemical high throughput confirmation assay for inhibitors of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504698 confirmatory 76 / 0 / 168 Fluorescence-based biochemical high throughput dose response assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504742 confirmatory 14 / 0 / 18 Fluorescence-based biochemical high throughput dose response assay for inhibitors of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
602231 other 0 / 0 / 4 Assay provider mechanism-of-action assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF): biochemical assay to identify activators of the Ca2+-sensitivity of cardiac muscle contraction/tension
602232 other 2 / 0 / 14 Assay provider mechanism-of-action assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF): absorbance-based biochemical assay to identify sensitizers of the Ca2+ sensitivity of cardiac myofibrillar ATPase
More...

Gene RIF (235)

PMID Text
26553696 Compromised interactions of K206I with actin and hcTnC may lead to impaired relaxation and HCM.
26553374 The incidence of adverse cardiovascular events was significantly higher in patients with troponin elevation after carotid endarterectomy, which was mainly attributable to silent non-ST segment elevation MIs that occurred in the early post-operative phase.
26506446 These findings showed that a double heterozygous mutation in the TNNI3 gene is involved in the pathogenesis of hypertrophic cardiomyopathy via haploinsufficiency.
26476506 hsTnI at the time of presentation followed by early advanced coronary CTA assessment improves the risk stratification and diagnostic accuracy for acute coronary syndromes.
26185217 Using an overall 99th percentile for cTnI does not appear to increase the prevalence of myocardial injury or lead to further hospital admissions from the emergency department.
26169204 Four novel missense variants were identified in TNNI3.
26111167 Troponin C (TnC) and the N-terminal helix of Troponin I (TnI N-helix), which occurs in vivo during muscle contraction.
26049777 In this pilot study, the addition of CACS to hsTnI improves the identification of low-risk subjects in whom CTA might be avoided.
25940119 mutations underlying restrictive cardiomyopathy all marked by right-sided cardiac manifestations in South African patients
25916738 Letter/Case Report: acute decompensated heart failure with troponin I elevation in hereditary hemochromatosis.
25887868 Abbott high-sensitivity cardiac-TnI levels in a total of 3314 Korean patients with chest pain, were determined.
25825410 hsTnI concentrations in the top tertile are associated with a 1st major cardiovascular event and all-cause mortality in a primary prevention cohort. Release may be due to myocardial cell necrosis, apoptosis, hemodynamic stress, or metabolic abnormalities.
25788439 Circulating levels of sensitive cTnI and NT-proBNP are related to LV function and infarct size in patients with stable CAD after revascularization.
25777344 Serum TnI detected significant myocardial necrosis in a majority of patients with chronic HF due to LVSD and when measured serially, provided independent risk information for poor CV outcomes and deleterious LV remodeling.
25653186 AF patients both without and with CAD showed similar cTnI concentrations at admission. A second validation of cTnI is mandatory for all patients.
25617100 The elevation of Tn I after PCI in patients with normal initial level is more significant predictor of early (30-day) mortality compared to later (within 12 months) mortality.
25601178 Carotid endarterectomy is followed by a high incidence of asymptomatic cTnI increase that is associated with late cardiac events.
25524337 In adult Hypertrophic Cardiomyopathy patients, thin-filament gene TNNI3 mutations are associated with increased likelihood of advanced Left Ventricular dysfunction and heart failure compared with thick-filament disease.
25518962 Resting troponin I-NH2-terminal truncated cardiomyocytes had shorter length than wild-type cells with no change in sarcomere length.
25451868 cTnI and cTnT concentrations are moderately correlated and measurable in plasma of most atrial fibrillation patients. The risk of stroke and cardiovascular events is highest when both troponins are above median concentrations.
25451703 Plasma cTnI is detectable during long-term follow-up after heart transplantation and is associated with graft rejection.
25403270 CTnI level of > 0.25 mug L(-1) at presentation in patients with thrombotic thrombocytopenic purpura appears to be an independent factor associated with a three-fold increase in the risk of death or refractoriness.
25381953 cardiac troponin T or troponin I compared to creatine kinase in patients with revascularized acute myocardial infarction
25296321 the effect of the S23D/S24D troponin I mutation on cardiac troponin structural dynamics
25261587 Absolute delta performed significantly better than relative delta at all time intervals to measure changes in troponin I for early diagnosis of myocardial infarction.
25252176 The functional integration of TnI phosphorylation may be a common mechanism to modulate Ser-23/24 phosphorylation function.
25246568 Data indicate that domain positioning impacts the effective concentration of cardiac isoform of troponin I (cTnI) presented to cardiac troponin C (cTnC).
25217621 Hybrid coronary revascularization is associated with lower postoperative cTn release, compared with off-pump coronary artery bypass surgery.
25195101 Even a single elevated Troponin I value increased the risk of myocardial infarction.
25141318 cTnI levels were higher in ischemics compared with those without myocardial ischemia when pre- and post-ERCP periods were compared.
25053882 In this review, we will discuss classic and emerging biomarkers of cardiovascular disease and the role of these biomarkers in the diagnosis and prognosis of elderly patients.
24899611 The levels of H-FABP, NT-proBNP, and cTnI were correlated with heart function, and can be used for the diagnosis of early-stageheart failure in children with congenital heart disease
24886208 There is a relationship between cTnI at the acute phase of acute myocardial infarction and extent of microvascular obstruction as assessed by 3-T cardiac MRI.
24794960 Troponin I levels were found to be a good biomarker to distinguish acute coronary syndrome from Takotsubo cardiomyopathy.
24794782 Serum concentrations of cTnI but not CK-MB or myoglobin are an independent predictor of all-cause mortality in patients with IDC.
24661773 Elevated high-sensitivity troponin-I in patients with diabetes mellitus type 2 is associated with increased cardiovascular mortality.
24660542 Elevations of cTnI not associated with ACS were common in patients with chronic kidney disease stage 3 to 5.
24626231 The high accordance with LGE, reflecting cardiac dysfunction, suggests that cTNI-elevation can be a useful laboratory parameter for assessing myocardial damage in FD.
24618063 Data indicate a high serum troponin I level after an acute episode of paroxysmal supraventricular tachycardia with normal coronary arteries via angiography.
24585742 Development of pathological hypertrophy did not occur in mice expressing both Tm180 and TnI-PP.
24521627 Further studies may reveal capability of salivary cTnI for being used for developing point-of-care testing for early detection of MI in pre-clinical settings.
24490734 Toponin I, T, and C play crucial roles in muscle activity, connecting changes in intracellular Ca2+ concentration with generation of contraction. [review]
24489430 Myocardial cTnI is an independent prognostic factor for cardiac outcomes in myocardial infarction.
24468543 In clinically stable patients undergoing elective coronary artery bypass grafting, measurements of cTnI are useful in ruling out a type 5 myocardial infarction.
24456881 Troponin I levels are often abnormal in atrial fibrillation patients.
24418317 Familial hypertrophic cardiomyopathy mutants cTnI R145G and cTnT R278C were tested alone and together in motility assays. Sliding at low Ca2+ (diastolic dysfunction) with cTnI R145G is worsened by cTnT R278C.
24383069 High troponin I levels are associated with epicardial coronary etiology for myocardial ischemia.
24316100 Exclusion of acute myocardial infarction 2h after presentation in emergency patients with possible acute coronary syndrome can be achieved using hs-cTnT or hs-cTnI assays.
24315342 Cardiac troponin I blood levels were increased in runners and walkers dependent on exercise intensity.
24291281 Early increases in Troponin I levels are linked to increased risk of cardiotoxicity in breast cancer patients undergoing doxorubicin and trastuzumab therapy.
24226808 In multivariable analysis, hs-TnI was significantly associated with stroke or systemic embolism, it was also significantly associated with cardiac death.
24206774 Elevated TnI levels are independently associated with cardiac and all-cause mortality in asymptomatic hemodialysis patients.
24101702 Cardiac TnI release is common before Norwood and BDG operations; then during the treatment protocol for hypoplastic left heart syndrome, cTnI release resolves.
24063930 High-sensitive levels of troponin detected before pre-aortic valve transplantation predict survival following the procedure.
23967088 A structural study of troponin I mutations found in hypertrophic cardiomyopathy patients indicate that the mutations result in a decrease in protein stability and loss of important interactions between the three troponin subunits.
23910445 Both absolute and relative changes in cardiac troponin I provided very high accuracy in the early diagnosis of acute myocardial infarction.
23886525 Troponin I serial measurements are useful for determining damage to the heart in myasthenia gravis-related cardiomyopathy.
23876467 Acute myocardial infarction was rapidly ruled out using undetectable levels of troponin I.
23829708 An elevated TnI in the context of acute liver injury or liver failure following paracetamol overdose is associated with a significantly worse patient outcome but it is not an independent prognostic factor.
23782526 Somatic mutations in MYH7, MYBPC3, TPM1, TNNT2, and TNNI3 do not represent an important etiologic pathway in HCM.
23660299 Both highly sensitive and conventional TnI were increased in gynecological cancer patients.
23604180 Report prognostic role of normal troponin values in diagnosis myocardial infarction.
23552626 Higher plasma Troponin I levels in coronary artery disease patients are associated with higher plasma phosphorus and calcium levels, and lower vitamin D levels.
23539503 Conclude that dilated cardiomyopathy-causing mutations in thin filament proteins abolish the relationship between myofilament Ca(2+) sensitivity and troponin I phosphorylation by PKA.
23469039 cardiac troponins and anti troponin autoantibodies in ventricular noncompaction/hypertrabeculation patients with/without reduced ejection fraction
23410486 Remote ischemic preconditioning does not contribute to exercise-induced increase in plasma troponin I.
23398826 Patients with brain injury following moderate head trauma have high levels of highly sensitive troponin I.
23397594 TnI levels rise significantly during hemodialysis and a greater intra-dialysis rise in cTnI is associated with an increased incidence of cardiovascular events
23396754 values of cTnI increase in the immediate postoperative period after cardiopulmonary bypass reaching a maximum and then decrease to normal within 4 to 5 days after surgery
23393062 Reviewed reports suggest Tn elevation commonly occurs in the setting of infectious encocarditis.
23329791 [REVIEW] Phosphorylation signaling to cardiac troponin I is integrated, with parallel signals controlling excitation-contraction coupling, hypertrophy, and metabolism.
23326389 Data show that TnIc G4s act cooperatively as enhancers in gene expression regulation in HEK293 cells, when stabilised by a synthetic G4-binding ligand.
23274622 In healthy children, cTnI is present in a Gaussian distribution.
23270746 A homozygous mutation in cardiac troponin I gene was found in a family with hypertrophic cardiomyopathy.
23247055 Our LFIA performance was additionally compared with electrochemiluminescence immunoassay (ECLI) detection for simultaneous determination of hs-cTnI and myoglobin in patients with suggestive of acute myocardial infarction .
23238359 Hs-cTnI is associated with adverse clinical outcome in patients with acute PE.
23220502 Data suggest that serum levels of cardiac Troponin I (cTnI) and high sensitivity C-reactive protein (hs-CRP) will be increased if the glucose-lowering rate is over this range, which means that cardiovascular endpoints might be induced.
23184341 Cardiac troponins I and T: molecular markers for early diagnosis, prognosis, and accurate triaging of patients with acute myocardial infarction.
23163407 cTnI release is more frequently associated with pressure than volume overload in children with congenital heart defects.
23144315 Data suggest that in the human myocardium, phosphorylation of both PKA sites on cTnI is required to reduce myofilament Ca(2+) sensitivity, which is maximal at ~55% bisphosphorylated cTnI.
22982904 Report high prevalence of positive cTnI in asymptomatic hemodialysis patients.
22876777 The novel R98Q was observed in a severe hypertrophic obstructive cardiomyopathy patient.
22761714 High cardiac troponin-I is associated with rheumatoid arthritis, independent of cardiovascular risk factors and inflammation
22704287 Patients with coronary anomalies and patients with reduced ventricular mass should benefit from the routine monitoring of cTn-I concentrations after surgery for congenital cardiac disease.
22675533 The disease-related protein modifications alter Ca(2+) binding by influencing both the association and dissociation rates of thin filament Ca(2+) exchange.
22633670 Elevated serum cardiac troponin I values are seen in Friedreich ataxia.
22560907 Troponin I concentrations in healthy individuals are dependent on prevalent cardiovascular diseases and risk factors.
22500757 differential histidine ionization may be necessary for cTnI A164H to act as a molecular sensor capable of modulating sarcomere performance in response to changes in the cytosolic milieu
22493448 the blunting effect of cTnI Ser-150 phosphorylation cross-talk can uncouple the effects of myofilament PKA-dependent phosphorylation from beta-adrenergic signaling as a novel thin filament contractile regulatory signaling mechanism.
22491666 cTnI was elevated in 28 patients with acute pulmonary embolism. An elevated cTnI level on admission significantly correlated with in-hospital mortality and major adverse clinical events.
22465126 Data indicate that utilizing delta cardiac troponin I (cTnI) values improves clinical specificity, diagnostic accuracy and risk assessment in patients presenting with symptoms of acute coronary syndrome.
22456184 Conclude that cTnI phosphorylation by AMPK may represent a novel mechanism of regulation of cardiac function.
22449338 Studies indicate that the cardiac troponin CVI value at 9 months in patients with stable cardiovascular disease was higher at 28% than the corresponding value at 2 months for healthy subjects at 14%.
22353438 Cardiac troponin I levels are associated with thromboembolic risk in patients with atrial fibrillation.
22119115 Persistence of troponin (Tn)I elevation in heart failure patients even at low levels is a worse survival indicator than recurrent TnI elevation, which portends a poor prognosis.
22072229 Plasma RAGE levels are elevated in patients with acute coronary syndrome with positive cTnI, suggesting that they could be related to myocardial cell damage.
22052454 These results suggest that the myocardium release of TnI during strenuous aerobic exercise mirrors that of troponin T.
22029801 A cellular autoimmune response to cTnI is demonstrated in a subset of patients with idiopathic dilated cardiomyopathy.
21993227 High sensitive troponins assay and BNP concentrations are associated with a greater extension of myocardial necrosis/myocardium at risk in unstable angina
21777381 Data provide further evidence regarding physiological function of C-terminal end segment of cardiac TnI; conformational change of C-terminal segment appears to be involved in Ca2+-regulated interaction of TnI with tropomyosin.
21757825 The serum cTnI level is a useful biomarker for evaluating myocardial damage associated with pulmonary hypertension in VSD children.
21730823 Postoperative cTnI levels seem to be superior to CK-MB and hs-CRP levels for the prediction of 1-year cardiovascular mortality and morbidity in patients undergoing elective vascular surgery.
21574239 Meta-analysis: cTnI or cTnT elevation after nonemergent percutaneous coronary intervention indicates of an increased long-term all-cause mortality as well as the composite adverse events of all-cause mortality and myocardial infarction.
21549291 Subjects with idiopathic dilated cardiomyopathy (iDCM) show significantly higher IL-10 responses to cardiac troponin (cTn)I compared with control subjects.
21456469 The overall efficacy of IMA[ischemia modified albumin] in differentiating AMI[Acute Myocardial Infarction] from Non-AMI cases appears to be comparable to that of CK-MB and cTnI
21304210 CTnI and BNP are useful parameters for identifying patients at risk for clinical deteriorations, and combined measurements of these biomarkers further improves the prognostic value of increased cardiovascular events in HCM.
21214502 Immunoblotting of blood samples from patients with acute ischemic stroke reveals similar degradation patterns of cTnI as has been described in patients with acute myocardial infarction.
21184543 Elevation of cTnI occurs in most patients undergoing elective, uncomplicated PCI. Deployment of multiple stents is associated with higher values of cTnI.
20975235 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20924643 Troponin elevations are frequent among patients receiving molecular targeted therapies.
20923987 elevated levels after percutaneous coronary intervention are associated with a modest increased risk of death
20889975 analysis of order and disorder in troponin C, T and I
20817590 Observational study of gene-disease association. (HuGE Navigator)
20800588 Observational study of genetic testing. (HuGE Navigator)
20624503 Observational study of gene-disease association. (HuGE Navigator)
20588136 A single troponin I value at 3 days from symptom onset is a better predictor of infarct size compared to peak values and CK-MB.
20555264 Preprocedural cTnI level is a strong and independent predictor of 30-day mortality and long-term major adverse cardiovascular events after PCI in the setting of acute coronary syndromes.
20523292 The absence of cardiac events and the association of valve surgery with higher early release of cTnI compared to CABG suggest that the type of surgery strongly affects the induction of myocardial damage.
20474083 Observational study of genetic testing. (HuGE Navigator)
20378771 After acute myocardial infarction, cTnI is present in serum as the ternary cTnT-cTnI-TnC (TIC) complex and binary cTnI-TnC (IC) complex.
20359594 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20358260 Combining troponin I blood levels with D-dimer tests enables early identification of low risk patients for myocardial infarction.
20215591 The Asp180Gly nucleotide alteration was identified in troponin I type 3 in 2 unrelated probands
20215591 Observational study of gene-disease association. (HuGE Navigator)
20188720 Patients with stable cardiovascular disease are found to have detectable high- sensitivity cardiac troponin I concentrations irrespective of their underlying disease.
20140242 Findings show no differences in coagulation parameters analyzed between cTnI-positive and -negative patients with SIRS, severe sepsis, and septic shock.
20086309 Screening of MYH7, cardiac ACTC and TNNI3 genes in dilated cardiomyopathy patients revealed two missense mutations, seven silent mutations, two polymorphisms in MYH7 gene, and two missense mutations and one silent mutation pertaining to TNNI3 gene.
20086309 Observational study of gene-disease association. (HuGE Navigator)
20079546 cTnI release is not limited to prolonged endurance activity and can be released following short-duration high-intensity exercise.
20043329 In patients with hypertrophic cardiomyopathy, serum cTnI was associated with important clinical indices such as maximum LV wall thickness, LV dysfunction, and male gender.
20035081 cTnI participates in proper stabilization of tropomyosin in the "Ca(2+)-activated state" or "C-state" on actin filaments.
20031618 Observational study of gene-disease association. (HuGE Navigator)
20030529 significant correlation and independent relation between cTnI and TNF-a in clinically asymptomatic hemodialysis patients
20025646 Compared with cTnl testing, pulmonary embolism severity index classification more accurately identified patients with PE who are at low risk of all-cause death within 30 days of presentation.
20008898 Postoperative cTnI level, measured within the first hour after cardiac surgery, can identify a subgroup of patients with increased risk for hospital mortality.
19925440 [review] TNNI3K is a novel cardiac troponin I-interacting kinase gene that may be involved in the development of cardiac hypertrophy.
19920153 cardiac troponin switches between alternative sets of intramolecular interactions, similar to previous intermediate resolution x-ray data of skeletal muscle troponin
19875404 Observational study of gene-disease association. (HuGE Navigator)
19853701 Observational study of gene-disease association. (HuGE Navigator)
19833747 Data show that elevated cardiac troponin T (cTnT), but not cTnI, was highly associated with creatine kinase in patients with idiopathic inflammatory myopathies despite the absence of myocardial ischemia.
19797054 Deletion of a genomic segment containing the cardiac troponin I gene knocks down expression of the slow troponin T gene and impairs fatigue tolerance of diaphragm muscle.
19696481 no predictive value for obstructive coronary artery disease in hemodialysis patients
19651143 In transgenic mice with troponin I R145W mutation, there is an increase in resistance to ventricular filling during diastole resulting in a decrease in ventricular filling (diastolic dysfunction).
19590045 2 novel TNNI3 missense mutations, Lys36Gln and Asn185Lys, each associated with severe and early onset familial DCM.
19590045 Observational study of gene-disease association. (HuGE Navigator)
19580729 Report impact of plaque composition on cardiac troponin elevation after percutaneous coronary intervention: an ultrasound analysis.
19571537 Degradation products of troponin I in hypertrophic obstructive cardiomyopathy patients undergoing percutaneous transluminal septal myocardial ablation appear fast and are similar to degradations following ST-elevation myocardial infarction.
19568166 Simultaneous measurement of cardiac troponin I with those of B-type natriuretic peptide and C-reactive protein improves the risk assessment of long-term adverse cardiac outcome after cardiac surgery.
19523464 The Dimension Vista cTnI, CK-MB, MYO, NTproBNP, and hsCRP methods demonstrate acceptable performance characteristics for use as an aid in the diagnosis and risk assessment of patients presenting with suspected acute coronary syndromes.
19463339 Assessing TnI72h after primary PCI is a simple, effective method to estimate infarct size, LVEF, and potentially useful for risk stratification.
19455094 Postoperative cardiac troponin I is an independent predictor of in-hospital death after coronary artery bypass grafting.
19426736 under acidic conditions PKC phosphorylation of cTnI residues at S43/S45 and at T144 is likely to have differential, but significant effects in depressing the ability of both Ca(2+) and rigor crossbridges to activate force generation
19387251 The combination of elevated CRP and cTnI increased the risk of adverse cardiac events after sirolimus-eluting stent implantation.
19372185 results demonstrate that interleukin-33 and troponin I assays can be multiplexed and retain the necessary precision, reproducibility, and sensitivity to be applied to new candidate biomarkers for verification of low-abundance proteins in blood
19321456 These data provide novel evidence identifying interactions of the hcTnI-N terminus with specific intra- and intermolecular sites.
19299763 Suggest that measurement of preoperative BNP and postoperative troponin I concentrations provides additive prognostic information for cardiovascular events and mortality after major vascular surgery.
19293840 Observational study of gene-disease association. (HuGE Navigator)
19221927 Cardiac troponin I is associated with a risk of premature cardiovascular death.
19150014 Observational study of gene-disease association. (HuGE Navigator)
19149795 Observational study of gene-disease association. (HuGE Navigator)
19145004 Elevated cTnI levels were significantly associated with short- and long-term mortality in ESRD patients with sepsis.
19090253 cardiac Troponin I has a role in acute myocardial infarct in hemodialysis patients
19035361 TNNI3 mutation was found invloved in hypertrophic cardiomyopathy.
19016149 Left ventricular mass index was significantly higher in patients with positive baseline cTnI than in those patients with negative cTnT.
19008306 there is a high incidence of post-operative troponin I rises in older patients undergoing emergency orthopaedic surgery with 1-year mortality and cardiac events being significantly increased in these patients
19003742 Patients with lower limb ischemia often have elevated troponin I without a primary cardiac source.
18986304 Mst1 is a novel mediator of cTnI phosphorylation in the heart and may contribute to the modulation of myofilament function under a variety of physiological and pathophysiological conditions
18976355 In total, 88% (15/18) of children with septic shock had elevated TnI levels compared with 25% (5/20) with sepsis and 6.7% (1/15) with hypovolaemic shock (p < 0.001).
18835219 troponin I (TnI) and high sensitivity C-reactive protein (hsCRP)blood levels were unchanged by exercise in trained athletes
18810980 Cardiac involvement of major thalassemia and evaluation of serum troponin I in these patients is reported.
18760145 Persistent cTnI elevation occurs frequently late after acute coronary syndrome.
18682663 Patients with infective endocarditis and increased cardiac troponin I levels have a higher incidence of in-hospital mortality or valve replacement than those with normal cardiac troponin I levels
18571749 Acute myocardial infarction (AMI) is identified significantly earlier by heart-type fatty acid-binding protein (H-FABP) than by cTnI in patients presenting to the Emergency Department suspected of AMI.
18569954 cTnI elevation after PCI predicts adverse outcome after one year in patients with acute coronary syndromes, but not in patients with stable angine pectoris.
18513529 Observational study of gene-disease association. (HuGE Navigator)
18445579 Top down MS of cTnI provides unique opportunities for unraveling its molecular complexity and for quantification of phosphorylated positional isomers.
18430738 addressed the functional consequences of the human cardiac troponin I (hcTnI) hypertrophic cardiomyopathy R145G mutation in transgenic mice
18403758 Observational study of gene-disease association. (HuGE Navigator)
18381864 At 8 hours postoperatively, cardiac troponin I led to an earlier diagnosis of perioperative myocardial infarction in coronary artery bypass patients.
18175163 the TNNI3 Pro82Ser alteration is likely a disease-modifying mutation in a severely affected individual, and, furthermore, carriers of this alteration (3% of African Americans) might be at increased risk of late-onset cardiac hypertrophy.
18175163 Observational study of genotype prevalence. (HuGE Navigator)
18094010 in haemodynamically stable patients with acute pulmonary embolism, cardiac troponin I was not an independent predictor of 30-day all-cause mortality, although it did predict fatal pulmonary embolism.
18092822 These results suggest that the perturbations of the N-domain caused by the Trp mutation disturb the interaction between TnC and TnI, which in turn diminishes the activity in fibers.
18064406 Postmortem cardiac troponin-I levels predict intramyocardial damage at autopsy.
18042776 Postoperative cardiac troponin I levels were not significantly different in coronary artery bypass grafting using single/double clamp technique.
18042489 Modulation of cardiac troponin C function by the cardiac-specific N-terminus of troponin I: influence of PKA phosphorylation and involvement in cardiomyopathies.
18032382 A troponin T mutation that causes infantile restrictive cardiomyopathy increases Ca2+ sensitivity of force development and impairs the inhibitory properties of troponin
17710247 Results indicate no differences in cardiac troponin-I levels between the appropriate-for-gestational-age and Intrauterine growth restriction groups.
17594788 Elevated serum cardiac troponin I concentrations is associated with diabetic ketoacidosis
17587709 Persistently increased serum concentrations of cardiac troponin (cTn) in patients with acutely decompensated heart failure are predictive of adverse outcomes.
17574519 Persistent platelet reactivity was not associated with increased risk of CK-MB and cTnI elevations in low-to-intermediate risk percutaneous coronary intervention patients.
17303066 The regulatory N-terminal domain of cardiac TnI is a dominant factor for the incompatibility in bacterial cells, supporting its role in modulating the overall molecular conformation.
17140583 Mutations of cardiac troponin I that exhibit increased Ca2+ sensitivity could affect the Ca2+ transient and mechanical response of a myocyte during a single cardiac cycle.
17101185 Observational study of gene-disease association. (HuGE Navigator)
17101185 spectrum of mutations in cardiac hypertrophy patients
16887211 IgG antibodies to TpnI are increased in a significant number of patients with both idiopathic dilated and ischemic cardiomyopathy, yet it appears that these autoantibodies cannot bind heart muscle cells or influence [Ca2+]i transients
16765375 beta1-adrenergic receptors are upregulated and troponin I is dephosphorylated in end-stage heart failure patients supported by ventricular assist devices
16754800 Observational study of gene-disease association. (HuGE Navigator)
16516408 The yeast cotransformation and GST fusion protein assay demonstrated the interaction between this new DSCR1L2 variant and the human cardiac troponin I.
16338248 Cardiac troponin I increases after exercise in athletes.
16302972 Results imply a hindered transduction of the protein kinase A phosphorylation signal from cardiac troponin I to troponin C.
16288990 both hypertrophic cardiomyopathy and restrictive cardiomyopathy involving cardiac troponin I mutations share a common feature of increased Ca2+ sensitivity of cardiac myofilament
16199542 Observational study of gene-disease association. (HuGE Navigator)
16157639 The crystal structure of troponin suggests that the Ca2+-binding to the regulatory TnC site displaces the N-terminal portion of TnI from actin/tropomyosin, thereby altering mobility/flexibility of the troponin/tropomyosin strand on the actin filament.
15961398 Data show that mutations in human cardiac troponin I that are associated with restrictive cardiomyopathy affect basal ATPase activity and the calcium sensitivity of force development.
15867176 An inhibitory domain mutation,cTnI(146Gly), was modeled; cTnI(146Gly) expression led to a leftward shift in the force-pCa2+ curves with cardiomyocyte disarray, fibrosis, and altered connexin43 organization.
15718266 Impairment in the regulatory function of cardiac troponin TnI by the mutation Arg145Gly leads to modulations in crossbridge kinetics that significantly alter the dynamics of myofibrillar contraction and relaxation.
15698845 Gene mutations in cardiac troponin I occur in Australian families with hypertrophic cardiomyopathy with a prevalence higher than previously reported and may be associated with a clinically more malignant course
15607392 The clinical expression of cardiac troponin I mutations was very heterogeneous and varied both within and between families with no apparent mutation- or gene-specific disease pattern.
15604421 NT-proBNP, cTnT, or cTnI do not have roles in acute ischemic stroke when other risk factors are considered
15350489 Can be used as a valid marker of acute myocardial injury in patients on maintenance dialysis.
15257080 cardiac troponin I may have a role in shock and progression to organ failure leading to mortality
15147183 Data suggest that activation of cardiac myofilaments is tightly coupled to the open state of the N-domain of cardiac troponin C, and that pathological effects of phosphorylation are influenced by mutations in cardiac troponin I.
15134451 Results confirm that the phosphorylation switch of cardiac troponin (Tn) I binds to troponin C via an extended interaction site spanning residues arginine-19 to alanine-34.
15070570 a novel TNNI3 mutation in a family with recessive disease. Functional studies showed impairment of troponin interactions that could lead to diminished myocardial contractility. TNNI3 is the first recessive gene identified for this condition.
15049709 The unphosphorylated N-terminal extension of cardiac troponin I binds to the N-terminal domain of troponin C via residues immediately terminal to the phosphorylation sites S22 and S23. Bisphosphorylation greatly weakens this binding interaction.
14661957 Modification of cardiac troponin I (cTnI) can have a pronounced effect on the binding affinity of cTnI for cardiac troponin C, which may correlate with altered cTnI myofilament function and cardiac muscle contraction under pathophysiological conditions.
14596793 Phosphorylation of mutant cardiac troponin I is linked to familial hypertrophic cardiomyopathy.
14575308 Calpain-dependent degradation of troponin I mutants was found in familial hypertrophic cardiomyopathy.
14551240 cTnI proteolysis may contribute to the pathophysiology of myocardial stunning by altering the Ca2+-sensing and chemomechanical properties of the myofilaments
12967628 A mutant TNNC1 (recombinant protein)interacted with levosimendan and cardiac troponin I peptides.
12840750 crystal structure of two kinds of core domain of human cardiac troponin in the Ca2+-saturated form; one at 2.6 A resolution and the other at 3.3 A resolution
12826210 Plasma levels may be reliable markers of heart transplantation outcomes.
12732641 Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I.
12721663 interacts specifically with TNNI3K
12525172 Several independent lines of evidence reveal that TNNI3 interacts with the carboxyl terminal domain (D682-V968) of polycystin 2.
12383268 the binding of the inhibitory region of troponin I to F-actin produces a conformational change in the actin monomer with the result that interaction at different locations of F-actin is impeded.
12270775 Cardiac troponin-I is not abnormally expressed in skeletal muscle of patients with ESRD (end stage renal disease)
12151382 single mutation corrects acid pH sensitivity of Ca2+-regulated actomyosin S1 ATPase
12044157 Perturbations of Thr142 phosphorylation and mutation Arg145Gly of the inhibitory region of cardiac troponin I (cIp) have an adverse effect on the binding of cIp to the Ca2+-saturated C-domain of cardiac troponin C.
11904166 Bisphosphorylated cTnI arm does not interact with cTnC, but with cTnT and/or cTnI.
11853553 Two mutations in troponin I that cause hypertrophic cardiomyopathy have contrasting effects on cardiac muscle contractility
11801593 Functional analysis of a troponin I (R145G) mutation associated with familial hypertrophic cardiomyopathy
11735257 TROPONIN I mutations in familial hypertrophic cardiomyopathy affect the regulatory processes involving TROPONIN I and increased the Ca(2+) sensitivity of cardiac muscle contraction
11596911 review of current knowledge of cTnI and its relationship with unstable angina and non-ischemic cardiac damage.

AA Sequence

MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRG      1 - 70
EKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFK     71 - 140
RPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES    141 - 210
//

Text Mined References (275)

PMID Year Title
26553696 2015 Green Tea Catechin Normalizes the Enhanced Ca2+ Sensitivity of Myofilaments Regulated by a Hypertrophic Cardiomyopathy-Associated Mutation in Human Cardiac Troponin I (K206I).
26553374 2016 Clinical Relevance of Cardiac Troponin Assessment in Patients Undergoing Carotid Endarterectomy.
26506446 2016 A Double Heterozygous Mutation of TNNI3 Causes Hypertrophic Cardiomyopathy in a Han Chinese Family.
26476506 2015 hs-Troponin I Followed by CT Angiography Improves Acute Coronary Syndrome Risk Stratification Accuracy and Work-Up in Acute Chest Pain Patients: Results From ROMICAT II Trial.
26185217 2015 Hospital Admission and Myocardial Injury Prevalence after the Clinical Introduction of a High-Sensitivity Cardiac Troponin I Assay.
26169204 2016 Identification of rare variants in TNNI3 with atrial fibrillation in a Chinese GeneID population.
26111167 2015 Coarse-Grained Modeling of Peptide Docking Associated with Large Conformation Transitions of the Binding Protein: Troponin I Fragment-Troponin C System.
26049777 2015 Low high-sensitivity troponin I and zero coronary artery calcium score identifies coronary CT angiography candidates in whom further testing could be avoided.
25940119 Diagnostic disparity and identification of two TNNI3 gene mutations, one novel and one arising de novo, in South African patients with restrictive cardiomyopathy and focal ventricular hypertrophy.
25916738 2015 A patient with a rare cause of elevated troponin I.
25887868 2015 The distribution of Abbott high-sensitivity troponin I levels in Korean patients with chest pain.
25825410 2015 High-sensitivity cardiac troponin I and B-type natriuretic Peptide as predictors of vascular events in primary prevention: impact of statin therapy.
25788439 2015 Sensitive cardiac troponins and N-terminal pro-B-type natriuretic peptide in stable coronary artery disease: correlation with left ventricular function as assessed by myocardial strain.
25777344 2015 Concentrations of highly sensitive cardiac troponin-I predict poor cardiovascular outcomes and adverse remodeling in chronic heart failure.
25653186 2015 Patients with atrial fibrillation complicated by coronary artery disease. Is a single value of sensitive cardiac troponin I on admission enough?
25617100 2014 Studies of troponin I level changes in patients with coronary artery disease after percutaneous coronary intervention.
25601178 2015 Cardiac troponin I after carotid endarterectomy in different cardiac risk patients.
25524337 2014 Clinical phenotype and outcome of hypertrophic cardiomyopathy associated with thin-filament gene mutations.
25518962 2015 NH2-terminal truncations of cardiac troponin I and cardiac troponin T produce distinct effects on contractility and calcium homeostasis in adult cardiomyocytes.
25451868 2015 Comparison of cardiac troponins I and T measured with high-sensitivity methods for evaluation of prognosis in atrial fibrillation: an ARISTOTLE substudy.
25451703 2015 Plasma ultrasensitive cardiac troponin during long-term follow-up of heart transplant recipients.
25403270 2015 Cardiac troponin-I on diagnosis predicts early death and refractoriness in acquired thrombotic thrombocytopenic purpura. Experience of the French Thrombotic Microangiopathies Reference Center.
25381953 2015 Kinetics of high-sensitivity cardiac troponin T or troponin I compared to creatine kinase in patients with revascularized acute myocardial infarction.
25296321 2014 Computational studies of the effect of the S23D/S24D troponin I mutation on cardiac troponin structural dynamics.
25261587 2015 Absolute and relative changes (delta) in troponin I for early diagnosis of myocardial infarction: Results of a prospective multicenter trial.
25252176 2014 Cardiac troponin I tyrosine 26 phosphorylation decreases myofilament Ca2+ sensitivity and accelerates deactivation.
25246568 2014 The cardiac-specific N-terminal region of troponin I positions the regulatory domain of troponin C.
25217621 2014 Cardiac troponin release following hybrid coronary revascularization versus off-pump coronary artery bypass surgery.
25195101 2015 Diagnostic performance of cardiac Troponin I for early rule-in and rule-out of acute myocardial infarction: Results of a prospective multicenter trial.
25141318 2014 Role of serum myeloperoxidase, CPK, CK-MB, and cTnI tests in early diagnosis of myocardial ischemia during ERCP.
25053882 2014 Biomarkers of acute myocardial infarction in the elderly: troponin and beyond.
24899611 2014 Diagnostic value of analysis of H-FABP, NT-proBNP, and cTnI in heart function in children with congenital heart disease and pneumonia.
24886208 2014 Microvascular obstruction assessed by 3-tesla magnetic resonance imaging in acute myocardial infarction is correlated with plasma troponin I levels.
24794960 2014 Cardiac biomarkers in Takotsubo cardiomyopathy.
24794782 The prognostic use of serum concentrations of cardiac troponin-I, CK-MB and myoglobin in patients with idiopathic dilated cardiomyopathy.
24661773 2014 Predictive value of high-sensitivity troponin-I for future adverse cardiovascular outcome in stable patients with type 2 diabetes mellitus.
24660542 2014 Cardiac troponin I in patients with chronic kidney disease stage 3 to 5 in conditions other than acute coronary syndrome.
24626231 2014 Continuous cardiac troponin I release in Fabry disease.
24618063 2014 Cardiac troponin I elevation with supraventricular tachycardia: two case reports and review of the literature.
24585742 2014 Desensitization of myofilaments to Ca2+ as a therapeutic target for hypertrophic cardiomyopathy with mutations in thin filament proteins.
24521627 2013 Salivary troponin I as an indicator of myocardial infarction.
24490734 2013 Human cardiac troponin complex. Structure and functions.
24489430 2013 Clinical use of ultrasensitive cardiac troponin I assay in intermediate- and high-risk surgery patients.
24468543 2014 Optimal cut-off value for cardiac troponin I in ruling out Type 5 myocardial infarction.
24456881 2014 Atrial fibrillation-induced cardiac troponin I release.
24418317 2014 Ca(2+)-regulatory function of the inhibitory peptide region of cardiac troponin I is aided by the C-terminus of cardiac troponin T: Effects of familial hypertrophic cardiomyopathy mutations cTnI R145G and cTnT R278C, alone and in combination, on filament sliding.
24383069 2013 Troponin I and the likelihood of hemodynamically significant coronary artery disease in patients with NSTE-ACS.
24316100 2014 Comparison of high sensitivity troponin T and I assays in the diagnosis of non-ST elevation acute myocardial infarction in emergency patients with chest pain.
24315342 2014 The impact of exercise intensity on cardiac troponin I release.
24291281 2014 Early increases in multiple biomarkers predict subsequent cardiotoxicity in patients with breast cancer treated with doxorubicin, taxanes, and trastuzumab.
24226808 2014 High-sensitivity troponin I for risk assessment in patients with atrial fibrillation: insights from the Apixaban for Reduction in Stroke and other Thromboembolic Events in Atrial Fibrillation (ARISTOTLE) trial.
24206774 2013 Elevated troponin I levels but not low grade chronic inflammation is associated with cardiac-specific mortality in stable hemodialysis patients.
24101702 2014 Cardiac troponin I, cardiac troponin-specific autoantibodies and natriuretic peptides in children with hypoplastic left heart syndrome.
24063930 2013 Preprocedural high-sensitive troponin predicts survival after transcatheter aortic valve implantation (TAVI).
23967088 2013 An in silico analysis of troponin I mutations in hypertrophic cardiomyopathy of Indian origin.
23910445 2013 Serial changes in high-sensitivity cardiac troponin I in the early diagnosis of acute myocardial infarction.
23886525 2013 Serial measurements of cardiac troponin I in patients with myasthenia gravis-related cardiomyopathy.
23876467 2013 Rapid rule out of acute myocardial infarction using undetectable levels of high-sensitivity cardiac troponin.
23829708 2013 Persistently elevated troponin I in paracetamol hepatotoxicity: association with liver injury, organ failure, and outcome.
23782526 2013 Somatic MYH7, MYBPC3, TPM1, TNNT2 and TNNI3 mutations in sporadic hypertrophic cardiomyopathy.
23660299 2013 Highly-sensitive troponin I is increased in patients with gynecological cancers.
23604180 2013 Normal presenting levels of high-sensitivity troponin and myocardial infarction.
23552626 2013 Troponin I, but not BNP, is associated with phosphorus, calcium and vitamin D in stable coronary artery disease.
23539503 2013 Familial dilated cardiomyopathy mutations uncouple troponin I phosphorylation from changes in myofibrillar Ca²? sensitivity.
23469039 2013 Troponin and anti-troponin autoantibody levels in patients with ventricular noncompaction.
23410486 2013 The effect of remote ischemic preconditioning on exercise-induced plasma troponin I appearance in healthy volunteers.
23398826 2013 The concentration of highly-sensitive troponin I is increased in patients with brain injury after mild head trauma.
23397594 2013 Determinants and prognostic significance of an intra-dialysis rise of cardiac troponin I measured by sensitive assay in hemodialysis patients.
23396754 2012 [Kinetics of cTnI and threshold values for the diagnosis of myocardial infarction after cardiac surgery with cardiopulmonary bypass].
23393062 2013 Prognostic value of cardiac troponin levels in infective endocarditis.
23369981 2013 TNNI3K is a novel mediator of myofilament function and phosphorylates cardiac troponin I.
23329791 2013 Integration of troponin I phosphorylation with cardiac regulatory networks.
23326389 2013 Possible regulatory roles of promoter g-quadruplexes in cardiac function-related genes - human TnIc as a model.
23274622 2013 The distribution of cardiac troponin I in a population of healthy children: lessons for adults.
23270746 2013 Homozygous mutation in the cardiac troponin I gene: clinical heterogeneity in hypertrophic cardiomyopathy.
23247055 2013 Evaluation of a modified lateral flow immunoassay for detection of high-sensitivity cardiac troponin I and myoglobin.
23238359 2013 Prediction of adverse clinical outcome in patients with acute pulmonary embolism: evaluation of high-sensitivity troponin I and quantitative CT parameters.
23220502 2013 Effects of the glucose-lowering rate on cTnI and hs-CRP serum levels in type 2 diabetics.
23184341 2012 Cardiac troponins I and T: molecular markers for early diagnosis, prognosis, and accurate triaging of patients with acute myocardial infarction.
23163407 2013 Cardiac troponin I in congenital heart defects with pressure or volume overload.
23144315 2013 Impact of site-specific phosphorylation of protein kinase A sites Ser23 and Ser24 of cardiac troponin I in human cardiomyocytes.
22982904 2012 Predictive value of cardiac troponin T and I in hemodialysis patients.
22972900 2012 Multiple reaction monitoring to identify site-specific troponin I phosphorylated residues in the failing human heart.
22876777 2012 High prevalence of Arginine to Glutamine substitution at 98, 141 and 162 positions in Troponin I (TNNI3) associated with hypertrophic cardiomyopathy among Indians.
22761714 2012 High-sensitivity cardiac troponin-I is elevated in patients with rheumatoid arthritis, independent of cardiovascular risk factors and inflammation.
22704287 2012 Early elevation of cardiac troponin I is predictive of short-term outcome in neonates and infants with coronary anomalies or reduced ventricular mass undergoing cardiac surgery.
22675533 2012 Disease-related cardiac troponins alter thin filament Ca2+ association and dissociation rates.
22633670 2013 Elevation of serum cardiac troponin I in a cross-sectional cohort of asymptomatic subjects with Friedreich ataxia.
22560907 2013 Defining a reference population to determine the 99th percentile of a contemporary sensitive cardiac troponin I assay.
22500757 2012 pH-responsive titratable inotropic performance of histidine-modified cardiac troponin I.
22493448 2012 AMP-activated protein kinase phosphorylates cardiac troponin I at Ser-150 to increase myofilament calcium sensitivity and blunt PKA-dependent function.
22491666 2012 Prognostic significance of cardiac troponin I on admission for surgical treatment of acute pulmonary embolism: a single-centre experience over more than 10 years.
22465126 2012 Delta changes for optimizing clinical specificity and 60-day risk of adverse events in patients presenting with symptoms suggestive of acute coronary syndrome utilizing the ADVIA Centaur TnI-Ultra assay.
22456184 2012 AMP-activated protein kinase phosphorylates cardiac troponin I and alters contractility of murine ventricular myocytes.
22449338 2012 Long-term biological variation in cardiac troponin I.
22353438 2013 Cardiac troponin I: prothrombotic risk marker in non-valvular atrial fibrillation.
22119115 2013 Recurrent low-level troponin I elevation is a worse prognostic indicator than occasional injury pattern in patients hospitalized with heart failure.
22072229 2011 Elevated soluble receptor for advanced glycation end product levels in patients with acute coronary syndrome and positive cardiac troponin I.
22052454 2012 Comparison of conventional and highly-sensitive troponin I measurement in ultra-marathon runners.
22029801 2011 Cellular proliferative response to cardiac troponin-I in patients with idiopathic dilated cardiomyopathy.
21993227 2011 High-sensitive troponin, B-type natriuretic peptide and coronary angiogram findings in patients with non ST-segment elevation acute coronary syndrome.
21846512 Clinical and mutational spectrum in a cohort of 105 unrelated patients with dilated cardiomyopathy.
21777381 2011 Calcium-regulated conformational change in the C-terminal end segment of troponin I and its binding to tropomyosin.
21757825 2011 Volume overload and pressure overload due to left-to-right shunt-induced myocardial injury. - Evaluation using a highly sensitive cardiac Troponin-I assay in children with congenital heart disease-.
21730823 2011 Postoperative levels of cardiac troponin versus CK-MB and high-sensitivity C-reactive protein for the prediction of 1-year cardiovascular outcome in patients undergoing vascular surgery.
21574239 2011 Prognostic value of cardiac troponin-I or troponin-T elevation following nonemergent percutaneous coronary intervention: a meta-analysis.
21569246 2011 Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C.
21549291 2011 Antiinflammatory autoimmune cellular responses to cardiac troponin I in idiopathic dilated cardiomyopathy.
21456469 2011 Diagnosis of ischemic heart disease using CK-MB, troponin-I and ischemia modified albumin.
21304210 2011 Combined measurements of cardiac troponin I and brain natriuretic peptide are useful for predicting adverse outcomes in hypertrophic cardiomyopathy.
21214502 2011 Troponin I degradation in serum of patients with acute ischemic stroke.
21184543 2010 Frequency, risk factors, and effect on long-term survival of increased troponin I following uncomplicated elective percutaneous coronary intervention.
20975235 2010 Impact of renin-angiotensin system polymorphisms on development of systolic dysfunction in hypertrophic cardiomyopathy. Evidence from a study of genotyped patients.
20924643 2012 Frequency and management of troponin I elevation in patients treated with molecular targeted therapies in phase I trials.
20923987 2010 Prognostic value of isolated troponin I elevation after percutaneous coronary intervention.
20889975 2010 Low temperature dynamic mapping reveals unexpected order and disorder in troponin.
20817590 2010 Analysis of the sarcomere protein gene mutation on cardiomyopathy - Mutations in the cardiac troponin I gene.
20800588 2010 Development of a high resolution melting method for the detection of genetic variations in hypertrophic cardiomyopathy.
20624503 Prevalence and spectrum of mutations in a cohort of 192 unrelated patients with hypertrophic cardiomyopathy.
20588136 2010 Predictive value of cardiac troponin-I compared to creatine kinase-myocardial band for the assessment of infarct size as measured by cardiac magnetic resonance.
20555264 2010 Prognostic significance of preprocedural troponin-I in patients with non-ST elevation acute coronary syndromes undergoing percutaneous coronary intervention.
20523292 2010 Cardiac valve surgery and myocardial damage: the role of cardiac troponin I.
20474083 2010 A novel custom resequencing array for dilated cardiomyopathy.
20378771 2010 Circulating immunoreactive cardiac troponin forms determined by gel filtration chromatography after acute myocardial infarction.
20359594 2010 Clinical features and outcome of hypertrophic cardiomyopathy associated with triple sarcomere protein gene mutations.
20358260 2010 Evaluation of the value of rapid D-dimer test in conjunction with cardiac troponin I test for early risk stratification of myocardial infarction.
20215591 2010 Coding sequence rare variants identified in MYBPC3, MYH6, TPM1, TNNC1, and TNNI3 from 312 patients with familial or idiopathic dilated cardiomyopathy.
20188720 2010 High-sensitive cardiac troponin I (hs-cTnI) values in patients with stable cardiovascular disease: an initial foray.
20140242 2010 Elevated cardiac troponin I in sepsis and septic shock: no evidence for thrombus associated myocardial necrosis.
20086309 2009 Novel mutations in beta-myosin heavy chain, actin and troponin-I genes associated with dilated cardiomyopathy in Indian population.
20079546 2010 Cardiac troponin I is released following high-intensity short-duration exercise in healthy humans.
20043329 2010 Serum cardiac troponin I is related to increased left ventricular wall thickness, left ventricular dysfunction, and male gender in hypertrophic cardiomyopathy.
20035081 2010 The C terminus of cardiac troponin I stabilizes the Ca2+-activated state of tropomyosin on actin filaments.
20031618 2009 Prevalence of sarcomere protein gene mutations in preadolescent children with hypertrophic cardiomyopathy.
20030529 2009 Factors related to silent myocardial damage in hemodialysis patients.
20025646 2010 Pulmonary Embolism Severity Index and troponin testing for the selection of low-risk patients with acute symptomatic pulmonary embolism.
20008898 2010 Cardiac troponin I levels after cardiac surgery as predictor for in-hospital mortality.
19925440 2009 TNNI3K could be a novel molecular target for the treatment of cardiac diseases.
19920153 2010 Troponin regulatory function and dynamics revealed by H/D exchange-mass spectrometry.
19875404 2009 The role of Lamin A/C mutations in Danish patients with idiopathic dilated cardiomyopathy.
19853701 2009 Histologic characterization of hypertrophic cardiomyopathy with and without myofilament mutations.
19833747 2009 Serum cardiac troponin T, but not troponin I, is elevated in idiopathic inflammatory myopathies.
19797054 2009 Deletion of a genomic segment containing the cardiac troponin I gene knocks down expression of the slow troponin T gene and impairs fatigue tolerance of diaphragm muscle.
19696481 2009 Prediction of hemodynamically significant coronary artery disease using troponin I in hemodialysis patients presenting with chest pain: A case-control study.
19651143 2009 Functional effects of a restrictive-cardiomyopathy-linked cardiac troponin I mutation (R145W) in transgenic mice.
19590045 2009 Identification and functional characterization of cardiac troponin I as a novel disease gene in autosomal dominant dilated cardiomyopathy.
19580729 2009 Impact of plaque composition on cardiac troponin elevation after percutaneous coronary intervention: an ultrasound analysis.
19571537 2009 Cardiac troponin I degradation in serum of patients with hypertrophic obstructive cardiomyopathy undergoing percutaneous septal ablation.
19568166 2009 Simultaneous measurement of cardiac troponin I, B-type natriuretic peptide, and C-reactive protein for the prediction of long-term cardiac outcome after cardiac surgery.
19523464 2009 Cardiovascular disease testing on the Dimension Vista system: biomarkers of acute coronary syndromes.
19463339 2008 Utility of cardiac biomarkers in predicting infarct size, left ventricular function, and clinical outcome after primary percutaneous coronary intervention for ST-segment elevation myocardial infarction.
19455094 2009 Postoperative cardiac troponin I is an independent predictor of in-hospital death after coronary artery bypass grafting.
19426736 2009 Differential effects of phosphorylation of regions of troponin I in modifying cooperative activation of cardiac thin filaments.
19387251 2009 Combination of C-reactive protein and cardiac troponin I for predicting adverse cardiac events after sirolimus-eluting stent implantation.
19372185 2009 Developing multiplexed assays for troponin I and interleukin-33 in plasma by peptide immunoaffinity enrichment and targeted mass spectrometry.
19321456 2009 Sites of intra- and intermolecular cross-linking of the N-terminal extension of troponin I in human cardiac whole troponin complex.
19299763 2009 A preliminary report on the prognostic significance of preoperative brain natriuretic peptide and postoperative cardiac troponin in patients undergoing major vascular surgery.
19293840 2009 The role of sarcomere gene mutations in patients with idiopathic dilated cardiomyopathy.
19221927 2009 Seemingly healthy 71-year-old men with minor elevations of cardiac troponin I and at risk of premature death in CVD have elevated levels of NT-proBNP: report from the ULSAM study.
19150014 2009 [Mutations in sarcomeric genes MYH7, MYBPC3, TNNT2, TNNI3, and TPM1 in patients with hypertrophic cardiomyopathy].
19149795 2009 Impact of QT variables on clinical outcome of genotyped hypertrophic cardiomyopathy.
19145004 2009 Prognostic value of elevated cardiac troponin I in ESRD patients with sepsis.
19090253 2007 Comparison of plasma cardiac Troponin I and cardiac enzymes in haemodialysis patients of Gorgan (south east of Iran).
19035361 2009 Diagnostic yield, interpretation, and clinical utility of mutation screening of sarcomere encoding genes in Danish hypertrophic cardiomyopathy patients and relatives.
19016149 2008 The relationship between cardiac troponins and left ventricular mass index in patients with chronic renal failure.
19008306 2009 Incidence of post-operative troponin I rises and 1-year mortality after emergency orthopaedic surgery in older patients.
19003742 2008 Cardiac troponin I in patients with acute upper and lower limb ischemia.
18986304 2009 Phosphorylation of cardiac troponin I by mammalian sterile 20-like kinase 1.
18976355 2009 Myocardial cell injury is common in children with septic shock.
18835219 2009 Effects of the whole-body cryotherapy on NTproBNP, hsCRP and troponin I in athletes.
18810980 2008 Cardiac involvement of major thalassemia and evaluation of total serum creatine kinase and creatine kinase-mB isoenzyme and cardiac troponinI in these patients.
18760145 2008 Pathophysiologic mechanisms of persistent cardiac troponin I elevation in stabilized patients after an episode of acute coronary syndrome.
18682663 2009 Patients with infective endocarditis and increased cardiac troponin I levels have a higher incidence of in-hospital mortality and valve replacement than those with normal cardiac troponin I levels.
18571749 2009 Human heart-type fatty acid-binding protein for on-site diagnosis of early acute myocardial infarction.
18569954 2008 Different prognostic importance of elevated troponin I after percutaneous coronary intervention in acute coronary syndrome and stable angina pectoris.
18513529 2008 Relationship between sex, shape, and substrate in hypertrophic cardiomyopathy.
18445579 2008 Unraveling molecular complexity of phosphorylated human cardiac troponin I by top down electron capture dissociation/electron transfer dissociation mass spectrometry.
18430738 2008 Functional consequences of the human cardiac troponin I hypertrophic cardiomyopathy mutation R145G in transgenic mice.
18403758 2008 Shared genetic causes of cardiac hypertrophy in children and adults.
18381864 2008 Cardiac troponin I vs EuroSCORE: myocardial infarction and hospital mortality.
18175163 2008 Familial hypertrophic cardiomyopathy associated with cardiac beta-myosin heavy chain and troponin I mutations.
18094010 2008 Troponin I and risk stratification of patients with acute nonmassive pulmonary embolism.
18092822 2008 Tryptophan mutants of cardiac troponin C: 3D structure, troponin I affinity, and in situ activity.
18064406 2008 Postmortem cardiac troponin-I levels predict intramyocardial damage at autopsy.
18042776 2007 Cardiac troponin I concentrations during on-pump coronary artery surgery.
18042489 2008 Modulation of cardiac troponin C function by the cardiac-specific N-terminus of troponin I: influence of PKA phosphorylation and involvement in cardiomyopathies.
18032382 2008 A troponin T mutation that causes infantile restrictive cardiomyopathy increases Ca2+ sensitivity of force development and impairs the inhibitory properties of troponin.
17710247 2007 Perinatal changes of cardiac troponin-I in normal and intrauterine growth-restricted pregnancies.
17594788 2007 Cardiac troponin I concentrations in people presenting with diabetic ketoacidosis.
17587709 2007 Persistently increased serum concentrations of cardiac troponin in patients with acutely decompensated heart failure are predictive of adverse outcomes.
17574519 2008 Effects of persistent platelet reactivity despite aspirin therapy on cardiac troponin I and creatine kinase-MB levels after elective percutaneous coronary interventions.
17303066 2007 Removing the regulatory N-terminal domain of cardiac troponin I diminishes incompatibility during bacterial expression.
17140583 2007 Computational simulation of hypertrophic cardiomyopathy mutations in troponin I: influence of increased myofilament calcium sensitivity on isometric force, ATPase and [Ca2+]i.
17101185 2007 Prevalence and spectrum of mutations in the sarcomeric troponin T and I genes in a cohort of Spanish cardiac hypertrophy patients.
16916777 2006 Urinary excretion of alpha1-microglobulin and albumin in acute myocardial infarction. Correlation with plasma concentrations of troponin I and C-reactive protein.
16887211 2007 Autoantibodies to cardiac troponin I in patients with idiopathic dilated and ischemic cardiomyopathy.
16765375 2006 Selective upregulation of beta1-adrenergic receptors and dephosphorylation of troponin I in end-stage heart failure patients supported by ventricular assist devices.
16754800 2006 Single-gene mutations and increased left ventricular wall thickness in the community: the Framingham Heart Study.
16516408 2006 Proteins encoded by human Down syndrome critical region gene 1-like 2 (DSCR1L2) mRNA and by a novel DSCR1L2 mRNA isoform interact with cardiac troponin I (TNNI3).
16358990 2005 Increased serum levels of troponin I and lesions in coronary angiography in hemodialysed patients.
16338262 2005 Relationship between anemia, cardiac troponin I, and B-type natriuretic peptide levels and mortality in patients with advanced heart failure.
16338248 2005 Independent elevations of N-terminal pro-brain natriuretic peptide and cardiac troponins in endurance athletes after prolonged strenuous exercise.
16302972 2005 Cardiac troponin C-L29Q, related to hypertrophic cardiomyopathy, hinders the transduction of the protein kinase A dependent phosphorylation signal from cardiac troponin I to C.
16288990 2005 Drastic Ca2+ sensitization of myofilament associated with a small structural change in troponin I in inherited restrictive cardiomyopathy.
16236952 2005 Myocardial injury in critically ill patients: relation to increased cardiac troponin I and hospital mortality.
16199542 2005 Compound and double mutations in patients with hypertrophic cardiomyopathy: implications for genetic testing and counselling.
16157639 2005 Crystal structure of troponin and the molecular mechanism of muscle regulation.
15961398 2005 Mutations in human cardiac troponin I that are associated with restrictive cardiomyopathy affect basal ATPase activity and the calcium sensitivity of force development.
15867176 2005 Transgenic rabbit model for human troponin I-based hypertrophic cardiomyopathy.
15718266 2005 Effects of the mutation R145G in human cardiac troponin I on the kinetics of the contraction-relaxation cycle in isolated cardiac myofibrils.
15698845 2005 Cardiac troponin I mutations in Australian families with hypertrophic cardiomyopathy: clinical, genetic and functional consequences.
15607392 2004 Frequency and clinical expression of cardiac troponin I mutations in 748 consecutive families with hypertrophic cardiomyopathy.
15604421 2005 Cardiac troponins and N-terminal pro-brain natriuretic peptide in acute ischemic stroke do not relate to clinical prognosis.
15601779 2004 Muscle-specific RING finger 1 is a bona fide ubiquitin ligase that degrades cardiac troponin I.
15542288 2004 Severe disease expression of cardiac troponin C and T mutations in patients with idiopathic dilated cardiomyopathy.
15514163 2004 Protein kinase D is a novel mediator of cardiac troponin I phosphorylation and regulates myofilament function.
15367881 2004 Elevated serum cardiac troponin I level in a patient after a grand mal seizure and with no evidence of cardiac disease.
15350489 Baseline cardiac troponin I in patients on maintenance dialysis.
15257080 2004 Cardiac troponin I levels are a risk factor for mortality and multiple organ failure in noncardiac critically ill patients and have an additive effect to the APACHE II score in outcome prediction.
15147183 2004 Effects of protein kinase C dependent phosphorylation and a familial hypertrophic cardiomyopathy-related mutation of cardiac troponin I on structural transition of troponin C and myofilament activation.
15134451 2004 NMR and mutagenesis studies on the phosphorylation region of human cardiac troponin I.
15070570 2004 Novel mutation in cardiac troponin I in recessive idiopathic dilated cardiomyopathy.
15049709 2004 Characterization of the interaction between the N-terminal extension of human cardiac troponin I and troponin C.
14661957 2003 Phosphorylation and mutation of human cardiac troponin I deferentially destabilize the interaction of the functional regions of troponin I with troponin C.
14596793 2003 Phosphorylation of human cardiac troponin I G203S and K206Q linked to familial hypertrophic cardiomyopathy affects actomyosin interaction in different ways.
14575308 2003 Calpain-1-dependent degradation of troponin I mutants found in familial hypertrophic cardiomyopathy.
14551240 2003 C-terminal truncation of cardiac troponin I causes divergent effects on ATPase and force: implications for the pathophysiology of myocardial stunning.
12974739 2003 Mutation spectrum in a large cohort of unrelated consecutive patients with hypertrophic cardiomyopathy.
12967628 2003 Interaction of levosimendan with cardiac troponin C in the presence of cardiac troponin I peptides.
12939162 2003 A cross-linking study of the N-terminal extension of human cardiac troponin I.
12840750 2003 Structure of the core domain of human cardiac troponin in the Ca(2+)-saturated form.
12826210 2003 Graft functional recovery and outcome after heart transplant: is troponin I a reliable marker?
12809519 2003 Troponin I binds polycystin-L and inhibits its calcium-induced channel activation.
12803836 2003 Measurement of cardiac troponin I in striated muscle using three experimental methods.
12732641 2003 Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I.
12721663 2003 Cloning and characterization of a novel cardiac-specific kinase that interacts specifically with cardiac troponin I.
12707239 2003 Hypertrophic cardiomyopathy: distribution of disease genes, spectrum of mutations, and implications for a molecular diagnosis strategy.
12626203 2002 Release patterns of pregnancy associated plasma protein A (PAPP-A) in patients with acute coronary syndromes.
12531876 2003 Idiopathic restrictive cardiomyopathy is part of the clinical expression of cardiac troponin I mutations.
12525172 2003 Polycystin-2 interacts with troponin I, an angiogenesis inhibitor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383268 2002 The inhibitory region of troponin-I alters the ability of F-actin to interact with different segments of myosin.
12270775 2002 Cardiac troponin-I content of skeletal muscle in patients with renal failure.
12242269 2002 p21-activated kinase increases the calcium sensitivity of rat triton-skinned cardiac muscle fiber bundles via a mechanism potentially involving novel phosphorylation of troponin I.
12242268 2002 Characterization and enrichment of cardiomyocytes derived from human embryonic stem cells.
12151382 2002 Single mutation (A162H) in human cardiac troponin I corrects acid pH sensitivity of Ca2+-regulated actomyosin S1 ATPase.
12122471 2002 Kinetic studies of calcium and cardiac troponin I peptide binding to human cardiac troponin C using NMR spectroscopy.
12093807 2002 Cardiac troponin T isoforms affect the Ca2+ sensitivity and inhibition of force development. Insights into the role of troponin T isoforms in the heart.
12060657 2002 Structure of the regulatory N-domain of human cardiac troponin C in complex with human cardiac troponin I147-163 and bepridil.
12044157 2002 Effects of T142 phosphorylation and mutation R145G on the interaction of the inhibitory region of human cardiac troponin I with the C-domain of human cardiac troponin C.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11904166 2002 The interaction of the bisphosphorylated N-terminal arm of cardiac troponin I-A 31P-NMR study.
11815426 2002 Sarcomere protein gene mutations in hypertrophic cardiomyopathy of the elderly.
11735257 2001 Functional consequences of the mutations in human cardiac troponin I gene found in familial hypertrophic cardiomyopathy.
11596911 2001 Cardiac troponin I: a biomarker for detection and risk stratification of minor myocardial damage.
11121119 2001 Additional PKA phosphorylation sites in human cardiac troponin I.
10850966 2000 Investigation of a truncated cardiac troponin T that causes familial hypertrophic cardiomyopathy: Ca(2+) regulatory properties of reconstituted thin filaments depend on the ratio of mutant to wild-type protein.
10806205 2000 Altered regulatory properties of human cardiac troponin I mutants that cause hypertrophic cardiomyopathy.
10387074 1999 Binding of cardiac troponin-I147-163 induces a structural opening in human cardiac troponin-C.
10191089 1999 Close physical linkage of human troponin genes: organization, sequence, and expression of the locus encoding cardiac troponin I and slow skeletal troponin T.
9605869 1997 Assignment of the human cardiac troponin I gene (TNNI3) to chromosome 19q13.4 by radiation hybrid mapping.
9560191 1998 Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
9346285 1997 The ordered phosphorylation of cardiac troponin I by the cAMP-dependent protein kinase--structural consequences and functional implications.
9241277 1997 Mutations in the cardiac troponin I gene associated with hypertrophic cardiomyopathy.
9219516 1997 Structural and functional domains of the troponin complex revealed by limited digestion.
8798526 1996 Phosphorylation specificities of protein kinase C isozymes for bovine cardiac troponin I and troponin T and sites within these proteins and regulation of myofilament properties.
8661099 1996 Isolation and characterization of the human cardiac troponin I gene (TNNI3).
8406024 1993 Cloning and expression in Escherichia coli of the cDNA encoding human cardiac troponin I.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7957210 1994 Overexpression of human cardiac troponin-I and troponin-C in Escherichia coli and their purification and characterisation. Two point mutations allow high-level expression of troponin-I.
2584239 1989 Identification of sites phosphorylated in bovine cardiac troponin I and troponin T by protein kinase C and comparative substrate activity of synthetic peptides containing the phosphorylation sites.
2226863 1990 A common motif of two adjacent phosphoserines in bovine, rabbit and human cardiac troponin I.
2226790 1990 Molecular cloning of human cardiac troponin I using polymerase chain reaction.
1959915 1991 The human cardiac troponin I locus: assignment to chromosome 19p13.2-19q13.2.
1934363 1991 Troponin I isoform expression in human heart.