Property Summary

Ligand Count 1
NCBI Gene PubMed Count 94
PubMed Score 12.68
PubTator Score 164.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
colon cancer 1.100 1.7e-02
Endometriosis -1.358 2.8e-02
interstitial cystitis -1.100 7.2e-04
lung adenocarcinoma -1.700 1.1e-16
lung cancer -2.100 5.5e-06
lung carcinoma -1.900 2.8e-22
malignant mesothelioma 3.800 3.0e-09
non-small cell lung cancer -4.464 4.8e-43
pituitary cancer -2.400 4.3e-08
psoriasis -3.000 6.7e-05

Protein-protein Interaction (12)

PDB (37)

Gene RIF (61)

AA Sequence

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSG      1 - 70
TVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDG     71 - 140
DKNNDGRIDYDEFLEFMKGVE                                                     141 - 161
//

Text Mined References (92)

PMID Year Title