Property Summary

NCBI Gene PubMed Count 9
PubMed Score 68.81
PubTator Score 7.28

Knowledge Summary


No data available


  Disease (4)


  Differential Expression (6)

Disease log2 FC p
breast carcinoma -1.200 2.3e-04
fibroadenoma -1.500 1.0e-02
sonic hedgehog group medulloblastoma 1.700 1.1e-02
invasive ductal carcinoma -1.623 1.3e-03
non-inflammatory breast cancer -2.400 9.6e-05
psoriasis -1.500 2.5e-25

Gene RIF (5)

26627873 This study demonstrated that the genetic defect was totally or partly clarified in 21 patients with nine of them having potential disease-causing mutations in TTN.
25868708 Results show that tenascin-W acts as a niche component for breast cancer metastasis to bone by supporting cell migration and cell proliferation of the cancer cells.
18306355 results reveal a clear association between elevated levels of tenascin-W and the presence of colorectal cancer and breast cancer
17909022 data imply that tenascin-W expression in the activated tumor stroma facilitates tumorigenesis by supporting the migratory behavior of breast cancer cells
15592496 The expression of tenascin-W is dependent on p38MAPK and JNK signaling pathways in mammary tumors. (tenascin-W)

AA Sequence

KGHEFSIPYVELKIRPHGYSREPVLGRKKRTLRGRLRTF                                  1261 - 1299

Text Mined References (10)

PMID Year Title
26627873 2016 Targeted next-generation sequencing assay for detection of mutations in primary myopathies.
25868708 2015 Transcriptional regulation of tenascin-W by TGF-beta signaling in the bone metastatic niche of breast cancer cells.
18306355 2008 Tenascin-W, a new marker of cancer stroma, is elevated in sera of colon and breast cancer patients.
17909022 2007 Tenascin-W is a novel marker for activated tumor stroma in low-grade human breast cancer and influences cell behavior.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15592496 2005 Tenascin-W is found in malignant mammary tumors, promotes alpha8 integrin-dependent motility and requires p38MAPK activity for BMP-2 and TNF-alpha induced expression in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12812753 2003 Tenascin-N: characterization of a novel member of the tenascin family that mediates neurite repulsion from hippocampal explants.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.