Property Summary

NCBI Gene PubMed Count 22
PubMed Score 67.14
PubTator Score 33.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.300 1.2e-19
posterior fossa group A ependymoma 1.900 5.0e-05
atypical teratoid / rhabdoid tumor 1.400 3.7e-02
Atopic dermatitis -2.200 4.7e-05
active ulcerative colitis -1.220 1.6e-02
Obesity 1.100 3.3e-02
Breast cancer -2.200 3.5e-02
breast carcinoma -1.400 4.5e-11
ductal carcinoma in situ -3.800 6.2e-04
invasive ductal carcinoma -4.300 1.4e-03

Gene RIF (12)

PMID Text
26880110 TNMD is upregulated in adipose tissue of insulin-resistant versus insulin-sensitive individuals. TNMD expression increases in human preadipocytes during differentiation, whereas silencing TNMD blocks adipogenesis.
23593173 results suggest that Tnmd acts on the maturation or maintenance of the PDL by positively regulating cell adhesion via its BRICHOS domain
22700804 Report differential expression and cellular localization of novel isoforms of the tendon biomarker tenomodulin and suggest possible roles in tenocyte proliferation and tendon injury.
19602561 Human adipose tissue TNMD gene expression is highly affected by obesity, adipose tissue location, and weight loss, indicating that TNMD may play a role in adipose tissue function.
19524323 According to these results the sequence variation of TNMD is not associated with alzheimer disease, but might modify the effect of APOE epsilon4-allele in women.
19524323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19381347 TNMD could be a novel candidate gene for age-related macular degeneration.
19381347 Observational study of gene-disease association. (HuGE Navigator)
18982016 Observational study of gene-disease association. (HuGE Navigator)
18838562 Tenomodulin is expressed abundantly in the elastin-rich subendothelial outer layer of the normal chordae tendineae cordis.
18580688 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17495183 Polymorphisms are associated with adiposity and also with glucose metabolism and conversion from glucose intolerance to type 2 diabetes.

AA Sequence

MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVPKKAYDMEHTFYS      1 - 70
NGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEID     71 - 140
ENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLISVSELQDFEEEGEDLHFPA    141 - 210
NEKKGIEQNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVC    211 - 280
EPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV                                     281 - 317
//

Text Mined References (23)

PMID Year Title
26880110 2016 Tenomodulin promotes human adipocyte differentiation and beneficial visceral adipose tissue expansion.
25416956 2014 A proteome-scale map of the human interactome network.
23593173 2013 Tenomodulin expression in the periodontal ligament enhances cellular adhesion.
22700804 2012 Differential expression and cellular localization of novel isoforms of the tendon biomarker tenomodulin.
19780194 2010 Tendon-selective genes identified from rat and human musculoskeletal tissues.
19602561 2009 Tenomodulin is highly expressed in adipose tissue, increased in obesity, and down-regulated during diet-induced weight loss.
19524323 2011 Tenomodulin variants, APOE and Alzheimer's disease in a Finnish case-control cohort.
19381347 2009 Single nucleotide polymorphisms of the tenomodulin gene (TNMD) in age-related macular degeneration.
18982016 2008 The genetic variation in the tenomodulin gene is associated with serum total and LDL cholesterol in a body size-dependent manner.
18838562 2008 Local tenomodulin absence, angiogenesis, and matrix metalloproteinase activation are associated with the rupture of the chordae tendineae cordis.
18580688 2008 The genetic variation of the tenomodulin gene (TNMD) is associated with serum levels of systemic immune mediators--the Finnish Diabetes Prevention Study.
17627542 2007 Chondromodulin-I and tenomodulin: the negative control of angiogenesis in connective tissue.
17495183 2007 Tenomodulin is associated with obesity and diabetes risk: the Finnish diabetes prevention study.
16019413 2005 Angiogenesis inhibitors localized in hypovascular mesenchymal tissues: chondromodulin-I and tenomodulin.
15950187 2005 Chondromodulin-I and tenomodulin: a new class of tissue-specific angiogenesis inhibitors found in hypovascular connective tissues.
15772651 2005 The DNA sequence of the human X chromosome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15150318 2004 Anti-angiogenic action of the C-terminal domain of tenomodulin that shares homology with chondromodulin-I.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11357195 2001 A novel gene, tendin, is strongly expressed in tendons and ligaments and shows high homology with chondromodulin-I.
11162673 2001 Molecular cloning of tenomodulin, a novel chondromodulin-I related gene.
11162640 2001 Molecular cloning and characterization of CHM1L, a novel membrane molecule similar to chondromodulin-I.