Property Summary

Ligand Count 8
NCBI Gene PubMed Count 16
PubMed Score 7.71
PubTator Score 8.18

Knowledge Summary

Patent (2,749)

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 9.9e-04
non primary Sjogren syndrome sicca 891 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alzheimer's disease 658 3.1 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 9.9e-04
non primary Sjogren syndrome sicca 1.300 1.4e-02

Gene RIF (9)

AA Sequence

MLPEAGSLWLLKLLRDIQLAQFYWPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLSEALKRLRSGP      1 - 70
KSKNWVYKILGGFAPEHKEPTLPSDSPRHLPEPEGGLKCLIPEGAVCRGELLGSGCFGVVHRGLWTLPSG     71 - 140
KSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHVLRLHGLVLGQPLQMVMELAPLGSLHARLTA    141 - 210
PAPTPPLLVALLCLFLRQLAGAMAYLGARGLVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMG    211 - 280
GPRPIPYAWCAPESLRHGAFSSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSR    281 - 350
ALYSLALRCWAPHPADRPSFSHLEGLLQEAGPSEACCVRDVTEPGALRMETGDPITVIEGSSSFHSPDST    351 - 420
IWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRN    421 - 490
MPLERMKGISRSLESVLSLGPRPTGGGSSPPEIRQARAVPQGPPGLPPRPPLSSSSPQPSQPSRERLPWP    491 - 560
KRKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEVELSVHGVTHQECQTALGATGGDVVSAIRNLKV    561 - 630
DQLFHLSSRSRADCWRILEHYQWDLSAASRYVLARP                                      631 - 666
//

Text Mined References (26)

PMID Year Title