Property Summary

NCBI Gene PubMed Count 29
PubMed Score 19.53
PubTator Score 27.97

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 2.000 8.2e-05
astrocytoma 1.200 3.8e-21
glioblastoma multiforme 1.300 1.2e-26
Atopic dermatitis 1.100 4.7e-05
pediatric high grade glioma 1.200 3.6e-05
pilocytic astrocytoma 1.100 2.5e-05
subependymal giant cell astrocytoma 1.023 3.3e-02
ovarian cancer 2.200 6.0e-07

Protein-protein Interaction (1)

Gene RIF (15)

PMID Text
26348204 miR let-7a-regulated USP35 can inhibit NF-kappaB activation by deubiquitination and stabilization of ABIN-2 protein
21784860 ABIN-2 acts as a positive regulator of NF-kappaB-dependent transcription by activating IKKalpha.
21266526 A20, ABIN-1/2, and CARD11 mutations have prognostic value in gastrointestinal diffuse large B-cell lymphoma
19898481 Observational study of gene-disease association. (HuGE Navigator)
19464428 This review defines ABIN-2 based on three different parameters: ability to bind A20; ability to inhibit NF-kappaB activation upon overexpression; the presence of specific short amino acid regions of strong homology, designated ABIN homology domains.
18622428 role for an ABIN-sensitive non-classical NF-kappaB signalling pathway in the proliferation of EGFR-overexpressing tumour cells.
17038805 Thus the present results showed a correlation between NF-kappaB activation and the repair of sublethal damage in split-dose irradiation.
16554025 Thus, CIH-mediated NF-kappaB activation may be a molecular mechanism linking OSA and cardiovascular pathologies seen in OSA patients.
16480954 ABIN-2 may function as a negative regulator that downregulates NF-kappaB activation during liver regeneration
15169888 optimal TPL-2 stability in vivo requires interaction with ABIN-2 as well as p105
12933576 ABIN-2 was found to inhibit endothelial apoptosis and rescue cells from death following growth factor deprivation. Deletion of the carboxy-terminus of ABIN-2 removed its ability to inhibit apoptosis.
12753905 ABIN-2 exerts unexpected function in mediating transcriptional coactivation.
12609966 Endothelial tyrosine kinase Tie2 interacts with ABIN-2.
12595760 FLIP1 has a role in the regulation of NF-kappaB activity related to the role of LKB1 in tumor suppression
12080044 transcription repressed by promyelocytic leukemia protein expression

AA Sequence

MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQ      1 - 70
VARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAAS     71 - 140
DVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEEN    141 - 210
RLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQ    211 - 280
ELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAG    281 - 350
RIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEEL    351 - 420
LRHVAECCQ                                                                 421 - 429
//

Text Mined References (33)

PMID Year Title
26348204 2015 USP35 activated by miR let-7a inhibits cell proliferation and NF-?B activation through stabilization of ABIN-2.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21784860 2011 A20-binding inhibitor of nuclear factor-kappaB (NF-kappaB)-2 (ABIN-2) is an activator of inhibitor of NF-kappaB (IkappaB) kinase alpha (IKKalpha)-mediated NF-kappaB transcriptional activity.
21266526 2011 A20, ABIN-1/2, and CARD11 mutations and their prognostic value in gastrointestinal diffuse large B-cell lymphoma.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
19464428 2009 ABINs: A20 binding inhibitors of NF-kappa B and apoptosis signaling.
18622428 2008 ABINs inhibit EGF receptor-mediated NF-kappaB activation and growth of EGF receptor-overexpressing tumour cells.
18212736 2008 Ubiquitin binding mediates the NF-kappaB inhibitory potential of ABIN proteins.
17038805 2007 Nuclear accumulation and activation of nuclear factor kappaB after split-dose irradiation in LS174T cells.
16633345 2006 ABIN-2 is required for optimal activation of Erk MAP kinase in innate immune responses.
16554025 2006 Chronic intermittent hypoxia activates nuclear factor-kappaB in cardiovascular tissues in vivo.
16480954 2006 Overexpression of ABIN-2, a negative regulator of NF-kappaB, delays liver regeneration in the ABIN-2 transgenic mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474016 2004 A20 is a potent inhibitor of TLR3- and Sendai virus-induced activation of NF-kappaB and ISRE and IFN-beta promoter.
15169888 2004 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14653779 2004 The inhibitor ABIN-2 disrupts the interaction of receptor-interacting protein with the kinase subunit IKKgamma to block activation of the transcription factor NF-kappaB and potentiate apoptosis.
12933576 2003 ABIN-2 protects endothelial cells from death and has a role in the antiapoptotic effect of angiopoietin-1.
12753905 2003 The A20-binding protein ABIN-2 exerts unexpected function in mediating transcriptional coactivation.
12609966 2003 The antiinflammatory endothelial tyrosine kinase Tie2 interacts with a novel nuclear factor-kappaB inhibitor ABIN-2.
12595760 An LKB1-interacting protein negatively regulates TNFalpha-induced NF-kappaB activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080044 2002 The promyelocytic leukemia protein represses A20-mediated transcription.
11390377 2001 Identification of a novel A20-binding inhibitor of nuclear factor-kappa B activation termed ABIN-2.
11389905 2001 Functional redundancy of the zinc fingers of A20 for inhibition of NF-kappaB activation and protein-protein interactions.
10385526 1999 The zinc finger protein A20 inhibits TNF-induced NF-kappaB-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal and directly binds to a novel NF-kappaB-inhibiting protein ABIN.