Property Summary

NCBI Gene PubMed Count 36
PubMed Score 62.94
PubTator Score 47.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.926 1.8e-04
glioblastoma 1.200 9.9e-03
tuberculosis -1.400 1.1e-04
interstitial cystitis 1.200 3.4e-02
adult high grade glioma 1.100 1.1e-03
pilocytic astrocytoma 1.200 4.5e-06
primary Sjogren syndrome 1.100 1.0e-03
subependymal giant cell astrocytoma 1.584 3.3e-02
invasive ductal carcinoma 1.511 3.4e-04
lung carcinoma -1.800 7.5e-18
ulcerative colitis 1.700 2.0e-03

Synonym

Accession P32971 O43404
Symbols CD153
CD30L
CD30LG
TNLG3A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (22)

PMID Text
25320285 TNFSF8 is an important leprosy T1R susceptibility gene.
25059065 soluble apoptosis markers as sFas-L, Caspase-9, Caspase-8 and sCD153 were significantly higher in stage III obesity patients compared obese patients without food allergy
24676358 The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus.
24447865 circulant sCD30L is functionally active and that it may favor persistence of active inflammation by inducing apoptosis of CD30(+)T cells, known to down-modulate inflammation in rheumatoid synovitis.
23333304 HIV-1 Vif upregulates the expression of tumor necrosis factor ligand superfamily, member 8 (TNFSF8) in Vif-expression T cells
22628304 a novel and unexpected role for CD30/CD30L that contributes to proinflammatory immune responses
22033252 The TNFSF8 polymorphisms rs927374 and rs2295800 were associated with neutrophil count. This finding suggests that post-MI inflammatory response is genetically modulated.
21480186 Positional candidate gene screening in the SPA2 locus allowed us to identify and replicate an association between a rare SNP located in TNFSF8 and spondylarthritis.
21292647 a possible role of novel TNFSF8 variants in susceptibility to lung cancer.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19657367 Single nucleotide polymorphism in TNFSF8 gene is associated with bone disease in myeloma.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19208589 CD153 antigen was expressed by synovial mast cells, and correlated with serum levels, in Rheumatoid Arthritis patients
18689277 results suggested a possible role of cd30 and cd30L in the pathogenesis of acute leukemia
18636124 Observational study of gene-disease association. (HuGE Navigator)
16964309 Mast cells were found to be the predominant CD30 ligand-positive (CD30L-positive) cell in the chronic inflammatory skin diseases psoriasis and atopic dermatitis.
16372246 CD30-L/CD30 and IL-6/IL-6R systems could play a major role in the pathogenesis of Graves'disease (GD), but the expression of CD30L/CD30 and IL-6/IL-6R in Hashimoto's thyroiditis (HT) suggests that Th2 mechanisms are involved in tissue damage.
12553555 only in a subset of both benign and malignant thyroid nodules the interleukin-6/interleukin-6 receptor signal could be induced by the CD30 ligand/CD30
11960307 Observational study of gene-disease association. (HuGE Navigator)
11728464 capability to up-regulate expression of CD30, release of soluble CD30 and production of IL-4 in pre-activated T cells upon co-culture

AA Sequence

MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPN      1 - 70
SPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYF     71 - 140
IICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDT    141 - 210
FQYIDTSTFPLENVLSIFLYSNSD                                                  211 - 234
//

Text Mined References (36)

PMID Year Title
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
25320285 2015 Association of TNFSF8 regulatory variants with excessive inflammatory responses but not leprosy per se.
25059065 2014 [Soluble apoptosis markers in obese patients with food intolerance].
24676358 2014 IgA measurements in over 12 000 Swedish twins reveal sex differential heritability and regulatory locus near CD30L.
24447865 2014 In rheumatoid arthritis soluble CD30 ligand is present at high levels and induces apoptosis of CD30(+)T cells.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22628304 2012 A novel role for reciprocal CD30-CD30L signaling in the cross-talk between natural killer and dendritic cells.
22033252 2011 Association of TNFSF8 polymorphisms with peripheral neutrophil count.
21480186 2011 Systematic candidate gene investigations in the SPA2 locus (9q32) show an association between TNFSF8 and susceptibility to spondylarthritis.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21292647 2011 Association of a novel functional promoter variant (rs2075533 C>T) in the apoptosis gene TNFSF8 with risk of lung cancer--a finding from Texas lung cancer genome-wide association study.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19657367 2009 Genetic polymorphisms of EPHX1, Gsk3beta, TNFSF8 and myeloma cell DKK-1 expression linked to bone disease in myeloma.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19208589 2009 CD153 in rheumatoid arthritis: detection of a soluble form in serum and synovial fluid, and expression by mast cells in the rheumatic synovium.
18689277 2007 Study of gene expression of CD30 variant (CD30v) and CD30 ligand (CD30L) in acute leukemia.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
16964309 2006 Mast cell CD30 ligand is upregulated in cutaneous inflammation and mediates degranulation-independent chemokine secretion.
16372246 2006 Immunoexpression of the CD30 ligand/CD30 and IL-6/IL-6R signals in thyroid autoimmune diseases.
12553555 2002 Co-expression of interleukin-6 (IL-6) and interleukin-6 receptor (IL-6R) in thyroid nodules is associated with co-expression of CD30 ligand/CD30 receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11960307 2002 Association study between CD30 and CD30 ligand genes and type 1 diabetes in the Japanese population.
11754357 2002 Soluble CD30 binds to CD153 with high affinity and blocks transmembrane signaling by CD30.
11751393 2001 Human angiogenin fused to human CD30 ligand (Ang-CD30L) exhibits specific cytotoxicity against CD30-positive lymphoma.
11728464 2001 CD30L up-regulates CD30 and IL-4 expression by T cells.
10878352 2000 Engagement of CD153 (CD30 ligand) by CD30+ T cells inhibits class switch DNA recombination and antibody production in human IgD+ IgM+ B cells.
9558389 1998 High CD30 ligand expression by epithelial cells and Hassal's corpuscles in the medulla of human thymus.
9524575 1998 CD30 and its ligand: possible role in regulation of teratoma stem cells.
9349718 1997 Characterisation of the human CD30 ligand gene structure.
8391931 1993 CD30 antigen, a marker for Hodgkin's lymphoma, is a receptor whose ligand defines an emerging family of cytokines with homology to TNF.
8161776 1994 Pleiotropic effects of the CD30 ligand on CD30-expressing cells and lymphoma cell lines.
7528856 1994 Expression and regulation of CD30 ligand and CD30 in human leukemia-lymphoma cell lines.