Property Summary

NCBI Gene PubMed Count 113
PubMed Score 247.40
PubTator Score 169.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Protein-protein Interaction (2)

Gene RIF (104)

PMID Text
26823868 Rs3810936 of TNFSF15 were related to the risk of ankylosing spondylitis
26810853 Biologics beyond TNF-alpha inhibitors and the effect of targeting the homologues TL1A-DR3 pathway in chronic inflammatory disorders.
26509650 TL1A-induced cell death is directly mediated through DR3.
26393680 Higher TL1A levels were associated with early stage chronic lymphocytic leukemia.
26200500 This study shows an association between TNFSF15-rs3810936 and AAU and suggests that the TL1A/DR3 pathway may be implicated in the pathogenesis of this disease.
26072972 The data indicate that TL1A may contribute to pathogenesis of inflammatory bowel diseases via local but not systemic induction of IL-17A but not IL-4, IL-13 or IFN-gamma.
26046454 Addition of TL1A to IL-1beta + IL-23 also augmented ILC3 proliferation
25929716 Plasma levels of TL1A were significantly higher in newly diagnosed SLE patients compared with controls, and were positively associated with SLE disease activity index.
25908025 TL1A blood levels are elevated in psoriasis patients; TL1A expression is higher in psoriatic lesions than in normal skin
25899471 Human primary biliary cirrhosis-susceptible allele of rs4979462 enhances TNFSF15 expression by binding NF-1.
25778932 This study indicates that the HDAC inhibitor may be exploited as a therapeutic strategy modulating the soluble VEGI/DR3 pathway in osteosarcoma patients
25664710 This is the first report of the association between early Crohn's disease and the TNFSF15 single nucleotide polymorphisms.
25647275 study has defined the increased serum and SF samples levels of TL1A and DcR3 in patients with rheumatoid arthritis (RA); findings support the hypothesis that TL1A and DcR3 may contribute to the pathogenesis of RA
25501099 associations exist between TNFSF15 gene polymorphisms and IBD (both CD and UC) in the Indian population
25399326 DR3 is expressed in some interstitial vascular endothelial cells (EC) in human kidney in situ; these EC also respond to its ligand TL1A by activating NF-kappaB.
25251497 Results show that subjects with TNFSF15 -358CC genotype were at higher risks for developing gastric adenocarcinoma in the Helicobacter pylori infected group.
25200589 Soluble TL1A synergized with IL-23 to stimulate peripheral blood mononuclear cells from patients with psoriasis vulgaris to produce IL-17.
25197060 Mechanisms mediating TNFSF15:DR3 contributions to pattern recognition receptor outcomes included TACE-induced TNFSF15 cleavage to soluble TNFSF15; soluble TNFSF15 then led to TRADD/FADD/MALT-1- and caspase-8-mediated autocrine IL-1 secretion.
25148371 TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells
25028192 This meta-analysis indicated that most of the seven TNFSF15 polymorphisms (except for rs4263839) were risk factors contributed to CD and UC susceptibility. The differences in ethnicity did not influence the risk obviously.
24835165 TNFSF15 SNPs, rs6478108 and rs4574921, may be independent genetic predictive factors for the development of stricture/non-perianal penetrating complications and perianal fistula, respectively.
24832108 These results suggested that TL1A could promote Th17 differentiation in rheumatoid arthritis via the activation of RORc, and this effect may be mediated by the binding of TL1A with DR3.
24814505 The SNP rs7848647 associated with the TNFSF15 gene is associated with surgical diverticulitis.
24783249 Combining the genetic marker TNFSF15 with ASCA IgA increased the power of predicting stenosis/perforating phenotype in Crohn's disease patients with TNFSF15 but not with a NOD2 genetic background
24384427 ADAMTS 8, CCL23, and TNFSF15 are implicated in anti-angiogenic activities
24269700 genetic polymorphism is associated with psoriasis and psoriatic arthritis in Hungarians
24220298 Our data demonstrate a key role for TL1A in promoting ILC2s at mucosal barriers.
24141405 Tumor-infiltrating natural killer and CD4(+) T cells under the influence of cancer cells significantly increase the production of IFNgamma, which in turn inhibits TNFSF15 expression in vascular endothelial cells.
24023314 VEGI, possibly via DR3, suppresses the aggressive nature of pituitary tumours and its expression level is closely linked to the invasion and destruction of the suprasellar and sella regions
24016146 may play an important role in the pathogenesis of primary biliary cirrhosis
24005100 It has been identified as a new disease susceptibility gene among Japanese. Though different from Europeans, it is indicated that a T lymphocyte differentiation route (Th1/Th17) shares a common disease developing process. [Review]
23642711 Response elements regulating TNFSF15 in primary human myeloid cells, were analyzed.
23598291 Circulating levels of TL1A correlate with the progression of atheromatous lesions in patients with rheumatoid arthritis
23545578 this suggests that VEGI functions mainly through inhibition of angiogenesis and is a negative regulator of aggressiveness during the development and progression of renal cell carcinoma .
23404494 attenuated S. typhimurium carrying the dual function plasmid VEGI151/survivin cannot only be specifically enriched in the tumor tissue, but also showed a synergistic antitumor effect in vivo.
23382586 VEGI192 and VEGI174 expression is markedly decreased in clear-cell renal cell carcinoma and are linked to pathological grade and stage.
23333304 HIV-1 Vpr upregulates the gene expression of TNFSF15 in human monocyte-derived dendritic cells
23250276 increased expressiojn in gut tissue , but not in the peripheral blood, from inflammatory bowel disease patients
23204549 TL1A is up-regulated in ankylosing spondylitis (AS), associates with disease activity and is influenced by anti-TNF treatment, suggesting that TL1A may be of pathogenic and potentially of therapeutic importance in AS patients.
23000144 Two significant susceptibility loci, TNFSF15 (rs4979462) and POU2AF1 (rs4938534) (combined odds ratio [OR] = 1.56, p = 2.84 x 10(-14) for rs4979462.
22684480 Polymorphisms in TNFSF15 were associated with irritable bowel syndrome with diarrhea.
22641456 Protein expression of tumour necrosis factor (TNF)-like ligand 1A (TL1A) and death-domain receptor (DR)3 is upregulated in the aged bladder tissues.
22210436 Vascular endothelial growth factor (VEGF) produced by cancer cells and monocyte chemotactic protein-1 (MCP-1) produced mainly by tumor-infiltrating macrophages and regulatory T cells effectively inhibits TNFSF15 production by endothelial cells.
21730793 the TNFSF15 genotype is positively associated with isolated colonic (L2) Crohn disease.
21672030 in active psoriasis, we observed abundant immunostaining for TL1A and significant upregulation of its receptors DR3 and DcR3
21636646 susceptibility gene for irritable bowel syndrome and irritable bowel syndrome constipation
21537832 DcR3 may act as an inducer, and membrane-bound TL1A may act as a receptor in rheumatoid synovial fibroblasts.
21368235 Substance P- and hemokinin-1-stimulated monocytes potentiate T helper type (Th)17 cell generation in vitro through IL-1beta, IL-23, and tumor necrosis factor-like (TNF)1A expression.
21300286 Decoy Receptor 3 (DcR3)neutralizes three different TNF ligands: FasL, LIGHT, and TL1A. Crystal structure of DcR3 reported here provides a mechanistic basis for the broadened specificity required to support the decoy function of DcR3.
21228792 neither TNFSF15 nor IL23R variants contribute to ulcerative colitis susceptibility in Koreans
21217782 studies for the first time establish the regulatory axis of AMPK-LITAF-TNFSF15 and also suggest that LITAF may function as a tumor suppressor
21153333 role of TNFRSF25:TNFSF15 in disease and health
21153332 role in inflammatory bowel disease pathogenesis
21072187 Observational study of gene-disease association. (HuGE Navigator)
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20863486 TL1A can regulate the inflammatory processes through modulation of the betaig-h3 expression through two separate pathways, one through PKC and PI3K and the other through ERK, which culminates at NF-kappaB activation.
20848476 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20675196 The TL1A/DcR3 ligand/receptor pair is upregulated in active ulcerative colitis.
20473688 Observational study of gene-disease association. (HuGE Navigator)
20410491 TL1A promotes foam cell formation in human macrophages in vitro by increasing low density lipoprotein uptake, by enhancing intracellular total and esterified cholesterol levels and reducing cholesterol efflux.
20367632 Observational study of gene-disease association. (HuGE Navigator)
20349123 TL1A increased cytotoxicity of IL-12/IL-18-activated NK cells against target cells dependent on NK activation for lysis and could function in vivo as a key co-activator of NK cytotoxicity.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20176734 Observational study of gene-disease association. (HuGE Navigator)
20150621 VEGI functions as a negative regulator of aggressiveness during development and progression of bladder cancer.
20125169 critically involved in the pathogenesis of rheumatoid arthritis
20018961 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19885571 VEGI functions as a negative regulator for aggressiveness during the development and progression of prostate cancer.
19839006 Our findings suggest a role for TL1A in pro-inflammatory APC-T cell interactions
19815424 Data suggest that lipopolysaccharide induces TL1A expression through the transcriptional activation via a NF-kappa B pathway.
19786547 these data suggest that TL1A secretion in lymphoid organs might contribute to rheumatoid arthritis initiation by promoting autoantibody production.
19760754 Observational study of gene-disease association. (HuGE Navigator)
19543369 A haplotype strongly associated with predisposition to spondyloarthritis is located near to TNFSF15.
19522538 Results provide insights into the structure and function of TL1A and provide the basis for the rational manipulation of its interactions with cognate receptors.
19422935 Observational study of gene-disease association. (HuGE Navigator)
19262684 TL1A gene variation exacerbates induction of TL1A in response to FcgammaR stimulation in Jewish CD patients and this may lead to chronic intestinal inflammation via overwhelming T cell responses
19262684 Observational study of gene-disease association. (HuGE Navigator)
19251437 sodium butyrate has different effects on lung vascular TNFSF15 (TL1A) expression in pulmonary artery and microvascular endothelial cells
19174806 confirms that TNFSF15 or a closely linked gene is involved in the genetic predisposition to CD
19174806 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19124533 The allelic expression imbalance of TNFSF15 in peripheral blood mononuclear cells was examined to reveal the effects of the single nucleotide polymorphisms on the transcriptional activity of TNFSF15.
18757243 TL1A may serve as an inflammatory marker in rheumatoid arthritis. Interactions between TL1A and its receptors may be important in the pathogenesis of rheumatois arthritis.
18422820 TNFSF15 genotypes play an important role in the pathogenesis of Crohn's disease in Koreans.
18422820 Observational study of gene-disease association. (HuGE Navigator)
18338776 Variants in TNFSF15 contribute to overall CD susceptibility in European populations, although to a lesser extent than that seen in the Japanese.
18338776 Observational study of gene-disease association. (HuGE Navigator)
18287561 TL1A may contribute to renal inflammation and injury through DR3-mediated activation of NF-kappaB and caspase-3
17935696 TL1A forms a homotrimer with each monomer assuming a jellyroll beta-sandwich fold. The CD loop in TL1A is the longest among the TNF ligand members with known structure and the AA' loop in TL1A is the second longest after that in TRAIL.
17663424 Observational study of gene-disease association. (HuGE Navigator)
17663424 TNFSF15 is an ethnic-specific IBD susceptibility gene. Five SNPs that comprise the 2 common haplotypes were genotyped in 599 Caucasian patients with Crohn's dis, 382 Caucasian patients with ulcerative colitis, and 230 controls.
17513783 Mononuclear phagocytes are a major source of TL1A in rheumatoid arthritis (RA), as revealed by their strong TL1A expression in either synovial fluids or synovial tissue of rheumatoid factor (RF)-seropositive RA patients, but not RF-negative/RA patients.
17371957 The induction of TL1A on APCs via specific pathway stimulation suggests a role for TL1A in Th1 responses to pathogens, and in CD.
17030188 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16966713 a significant association between TNFSF15 and Crohn's disease
16604264 It can be concluded that VEGI72-251 is able to increase the level of human IL-2 production by the activation of T lymphocytes
16221758 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16221758 Genetic variations in the TNFSF15 gene contribute to the susceptibility to inflammatory bowel diseases in Japanese and European populations.
16061878 VEGI is an endogenous inhibitor of angiogenesis
15760679 TL1A and DR3 is involved in atherosclerosis via the induction of pro-inflammatory cytokines/chemokines
15207783 Expression of TL1A and its receptor DR3 by lamina propria mononuclear cells (LPMC) could have significant influence on the severity of mucosal inflammation.
14568967 TL1A mRNA and protein expression is up-regulated in inflammatory bowel disease, particularly in involved areas of Crohn's disease (CD) in gut mucosa cell types other than endothelial, including lamina propria lymphocytes as well as tissue macrophages.
12882979 TL1A-induced NF-kappaB activation and c-IAP2 production prevent DR3-mediated apoptosis
11739281 Vascular endothelial growth inhibitor is an endothelial cell-specific gene and inhibitor of endothelial cell proliferation, angiogenesis, and tumor growth; mediates G1 arrest in G0/G1 cells responding to growth stimuli, and apoptosis in cell division
2611899 HIV-1 Vpr upregulates the gene expression of TNFSF15 in human monocyte-derived dendritic cells

AA Sequence

MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQ      1 - 70
ALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLL     71 - 140
IPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQ    141 - 210
PIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL                                 211 - 251
//

Text Mined References (116)

PMID Year Title
26823868 2015 Genetic analysis of TNFST15 variants in ankylosing spondylitis.
26810853 2016 Biologics beyond TNF-? inhibitors and the effect of targeting the homologues TL1A-DR3 pathway in chronic inflammatory disorders.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26509650 2016 Soluble TL1A is sufficient for activation of death receptor 3.
26393680 2015 Expression and function of the TL1A/DR3 axis in chronic lymphocytic leukemia.
26200500 2015 Association of Genetic Variations in TNFSF15 With Acute Anterior Uveitis in Chinese Han.
26072972 2015 TL1A as a Potential Local Inducer of IL17A Expression in Colon Mucosa of Inflammatory Bowel Disease Patients.
26046454 2015 Human group3 innate lymphoid cells express DR3 and respond to TL1A with enhanced IL-22 production and IL-2-dependent proliferation.
25929716 2015 Elevated plasma levels of TL1A in newly diagnosed systemic lupus erythematosus patients.
25908025 2015 Secretion, blood levels and cutaneous expression of TL1A in psoriasis patients.
25899471 2015 Human primary biliary cirrhosis-susceptible allele of rs4979462 enhances TNFSF15 expression by binding NF-1.
25778932 2015 Sodium valproate, a histone deacetylase inhibitor, modulates the vascular endothelial growth inhibitor-mediated cell death in human osteosarcoma and vascular endothelial cells.
25664710 2015 Genetic determinants associated with early age of diagnosis of IBD.
25647275 2015 Serum and synovial fluid levels of tumor necrosis factor-like ligand 1A and decoy receptor 3 in rheumatoid arthritis.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25501099 2014 Protective association of tumor necrosis factor superfamily 15 (TNFSF15) polymorphic haplotype with Ulcerative Colitis and Crohn's disease in an Indian population.
25399326 2014 TL1-A can engage death receptor-3 and activate NF-kappa B in endothelial cells.
25251497 2014 Functional genetic variants of TNFSF15 and their association with gastric adenocarcinoma: a case-control study.
25200589 2014 TNF-like ligand 1A is associated with the pathogenesis of psoriasis vulgaris and contributes to IL-17 production in PBMCs.
25197060 2014 A TNFSF15 disease-risk polymorphism increases pattern-recognition receptor-induced signaling through caspase-8-induced IL-1.
25148371 2014 TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells.
25028192 2014 Associations between TNFSF15 polymorphisms and susceptibility to ulcerative colitis and Crohn's disease: A meta-analysis.
24835165 2014 TNFSF15 is an independent predictor for the development of Crohn's disease-related complications in Koreans.
24832108 2014 TL1A increased the differentiation of peripheral Th17 in rheumatoid arthritis.
24814505 2014 The TNFSF15 gene single nucleotide polymorphism rs7848647 is associated with surgical diverticulitis.
24783249 2014 Combining TNFSF15 and ASCA IgA can be used as a predictor for the stenosis/perforating phenotype of Crohn's disease.
24676358 2014 IgA measurements in over 12 000 Swedish twins reveal sex differential heritability and regulatory locus near CD30L.
24384427 2014 Genome-wide study reveals an important role of spontaneous autoimmunity, cardiomyocyte differentiation defect and anti-angiogenic activities in gender-specific gene expression in Keshan disease.
24269700 2014 Genetic risk and protective factors of TNFSF15 gene variants detected using single nucleotide polymorphisms in Hungarians with psoriasis and psoriatic arthritis.
24220298 2014 TNF superfamily member TL1A elicits type 2 innate lymphoid cells at mucosal barriers.
24141405 2014 Interferon-? produced by tumor-infiltrating NK cells and CD4+ T cells downregulates TNFSF15 expression in vascular endothelial cells.
24023314 2013 Vascular endothelial growth inhibitor (VEGI) is an independent indicator for invasion in human pituitary adenomas.
24016146 2014 Systemic and local expression levels of TNF-like ligand 1A and its decoy receptor 3 are increased in primary biliary cirrhosis.
24005100 2013 [Analysis of disease-pathway by susceptibility genes in primary biliary cirrhosis].
23642711 2013 Multiple activating and repressive cis-promoter regions regulate TNFSF15 expression in human primary mononuclear cells.
23598291 2013 Circulating levels of TNF-like cytokine 1A correlate with the progression of atheromatous lesions in patients with rheumatoid arthritis.
23545578 2013 Suppression of renal cell carcinoma growth in vivo by forced expression of vascular endothelial growth inhibitor.
23404494 2013 Recombinant attenuated Salmonella typhimurium carrying a plasmid co-expressing ENDO-VEGI151 and survivin siRNA inhibits the growth of breast cancer in vivo.
23382586 The differential expression of vascular endothelial growth inhibitor isoforms, VEGI251, VEGI174 and VEGI192 in human clear-cell renal cell carcinoma.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23250276 2013 TL1A/TNFSF15 directly induces proinflammatory cytokines, including TNF?, from CD3+CD161+ T cells to exacerbate gut inflammation.
23204549 2013 Increased levels of soluble TNF-like cytokine 1A in ankylosing spondylitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23000144 2012 Genome-wide association study identifies TNFSF15 and POU2AF1 as susceptibility loci for primary biliary cirrhosis in the Japanese population.
22684480 2013 Identifying and testing candidate genetic polymorphisms in the irritable bowel syndrome (IBS): association with TNFSF15 and TNF?.
22641456 2012 Involvement of TL1A and DR3 in induction of ischaemia and inflammation in urinary bladder dysfunction in the elderly.
22210436 2012 Down-modulation of TNFSF15 in ovarian cancer by VEGF and MCP-1 is a pre-requisite for tumor neovascularization.
21730793 2011 Influence of Crohn's disease risk alleles and smoking on disease location.
21699788 2011 HLA-Cw*1202-B*5201-DRB1*1502 haplotype increases risk for ulcerative colitis but reduces risk for Crohn's disease.
21672030 2011 Upregulation and nuclear localization of TNF-like cytokine 1A (TL1A) and its receptors DR3 and DcR3 in psoriatic skin lesions.
21636646 2011 Association of TNFSF15 polymorphism with irritable bowel syndrome.
21537832 2011 DcR3-TL1A signalling inhibits cytokine-induced proliferation of rheumatoid synovial fibroblasts.
21368235 2011 The tachykinins substance P and hemokinin-1 favor the generation of human memory Th17 cells by inducing IL-1?, IL-23, and TNF-like 1A expression by monocytes.
21300286 2011 Decoy strategies: the structure of TL1A:DcR3 complex.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21228792 2011 No association between TNFSF15 and IL23R with ulcerative colitis in Koreans.
21217782 2011 LITAF and TNFSF15, two downstream targets of AMPK, exert inhibitory effects on tumor growth.
21153333 2011 The role of TNFRSF25:TNFSF15 in disease… and health?
21153332 2011 Insights into TL1A and IBD pathogenesis.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20863486 2010 TL1A induces the expression of TGF-?-inducible gene h3 (?ig-h3) through PKC, PI3K, and ERK in THP-1 cells.
20848476 2010 Genetic predictors of medically refractory ulcerative colitis.
20675196 2010 High intestinal and systemic levels of decoy receptor 3 (DcR3) and its ligand TL1A in active ulcerative colitis.
20473688 2010 Association between genome-wide association studies reported SNPs and pediatric-onset Crohn's disease in Canadian children.
20410491 2010 The TNF-like protein 1A-death receptor 3 pathway promotes macrophage foam cell formation in vitro.
20367632 2010 Population-specific susceptibility to Crohn's disease and ulcerative colitis; dominant and recessive relative risks in the Japanese population.
20349123 2010 TL1A selectively enhances IL-12/IL-18-induced NK cell cytotoxicity against NK-resistant tumor targets.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20176734 2010 Comparative genetic analysis of inflammatory bowel disease and type 1 diabetes implicates multiple loci with opposite effects.
20150621 2010 Expression of vascular endothelial growth inhibitor (VEGI) in human urothelial cancer of the bladder and its effects on the adhesion and migration of bladder cancer cells in vitro.
20125169 2010 Immunology: TL1A in the inflammatory network in autoimmune diseases.
20018961 2009 Genomewide association study of leprosy.
19885571 2009 Vascular endothelial growth inhibitor, expression in human prostate cancer tissue and the impact on adhesion and migration of prostate cancer cells in vitro.
19839006 2009 Microbial induction of inflammatory bowel disease associated gene TL1A (TNFSF15) in antigen presenting cells.
19815424 2010 Involvement of NF-kappa B pathway in TL1A gene expression induced by lipopolysaccharide.
19786547 2009 Role of TL1A in the pathogenesis of rheumatoid arthritis.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19543369 2009 Comprehensive linkage and association analyses identify haplotype, near to the TNFSF15 gene, significantly associated with spondyloarthritis.
19522538 2009 Biochemical and structural characterization of the human TL1A ectodomain.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19262684 2009 IBD-associated TL1A gene (TNFSF15) haplotypes determine increased expression of TL1A protein.
19251437 2009 Effect of sodium butyrate on lung vascular TNFSF15 (TL1A) expression: differential expression patterns in pulmonary artery and microvascular endothelial cells.
19174806 2009 TNFSF15 polymorphisms are associated with susceptibility to inflammatory bowel disease in a new European cohort.
19124533 2009 TNFSF15 transcripts from risk haplotype for Crohn's disease are overexpressed in stimulated T cells.
18758464 2008 Loci on 20q13 and 21q22 are associated with pediatric-onset inflammatory bowel disease.
18757243 2008 Circulating levels of TNF-like cytokine 1A (TL1A) and its decoy receptor 3 (DcR3) in rheumatoid arthritis.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
18422820 2008 Association of TNFSF15 with Crohn's disease in Koreans.
18338776 2008 Contribution of TNFSF15 gene variants to Crohn's disease susceptibility confirmed in UK population.
18287561 2008 TL1A both promotes and protects from renal inflammation and injury.
17935696 2007 X-ray crystal structure of TNF ligand family member TL1A at 2.1A.
17663424 2007 TNFSF15 is an ethnic-specific IBD gene.
17513783 2007 Soluble TNF-like cytokine (TL1A) production by immune complexes stimulated monocytes in rheumatoid arthritis.
17371957 2007 The T cell costimulator TL1A is induced by FcgammaR signaling in human monocytes and dendritic cells.
17030188 2006 TUCAN (CARD8) genetic variants and inflammatory bowel disease.
16966713 2006 Association study of TNFSF15 polymorphisms in Japanese patients with inflammatory bowel disease.
16604264 2006 Isoform of vascular endothelial cell growth inhibitor (VEGI72-251) increases interleukin-2 production by activation of T lymphocytes.
16221758 2005 Single nucleotide polymorphisms in TNFSF15 confer susceptibility to Crohn's disease.
16061878 2005 VEGI-192, a new isoform of TNFSF15, specifically eliminates tumor vascular endothelial cells and suppresses tumor growth.
15760679 2005 Involvement of TL1A and DR3 in induction of pro-inflammatory cytokines and matrix metalloproteinase-9 in atherogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15207783 2004 Potential role for TL1A, the new TNF-family member and potent costimulator of IFN-gamma, in mucosal inflammation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14568967 2003 Expression, localization, and functional activity of TL1A, a novel Th1-polarizing cytokine in inflammatory bowel disease.
12882979 2003 TL1A-induced NF-kappaB activation and c-IAP2 production prevent DR3-mediated apoptosis in TF-1 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11923219 2002 A novel secreted splice variant of vascular endothelial cell growth inhibitor.
11911831 2002 TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator.
10597252 1999 VEGI, a new member of the TNF family activates nuclear factor-kappa B and c-Jun N-terminal kinase and modulates cell growth.
9880523 1999 TL1, a novel tumor necrosis factor-like cytokine, induces apoptosis in endothelial cells. Involvement of activation of stress protein kinases (stress-activated protein kinase and p38 mitogen-activated protein kinase) and caspase-3-like protease.
9872942 1999 VEGI, a novel cytokine of the tumor necrosis factor family, is an angiogenesis inhibitor that suppresses the growth of colon carcinomas in vivo.
9434163 1997 Characterization of a novel TNF-like ligand and recently described TNF ligand and TNF receptor superfamily genes and their constitutive and inducible expression in hematopoietic and non-hematopoietic cells.
12345 1976 A new granulation method for compressed tablets [proceedings].