Property Summary

NCBI Gene PubMed Count 496
PubMed Score 3934.60
PubTator Score 1951.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.340 4.1e-03
tuberculosis -1.100 9.6e-05
intraductal papillary-mucinous carcinoma... 1.900 5.4e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.0e-02
lung cancer 1.800 2.9e-04
pancreatic cancer 1.400 1.8e-03
cystic fibrosis -1.300 8.2e-04
nasopharyngeal carcinoma -1.200 2.0e-03
inflammatory breast cancer -1.400 9.4e-03
ulcerative colitis 1.400 9.1e-04
ovarian cancer 1.100 1.4e-09
pituitary cancer 1.100 2.9e-03

Protein-protein Interaction (7)

Gene RIF (486)

PMID Text
26975539 The plasma OPG level is negatively associated with nonalcoholic fatty liver disease independent of potential cofounders
26894886 Mast cell density and expression of MMP-9, RANKL and Ntx correlated positively with of bone disease severity in multiple myeloma patients.
26722486 Hypoxia can affect the expression of RANKL and OPG in human periodontal ligament cells
26635910 the independent and positive (beta = 0.449, p = 0.004, and R(2) = 0.185) association between the OxS marker and RANKL/OPG ratio which was found in osteopenic but not in the other 2 sample groups.
26629528 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-kappaB Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers
26621504 In conclusion, rheumatoid arthritis synovial fibroblasts were activated by CXCL16 to produce RANKL via pathways involving JAK2/STAT3 and p38/MAPK
26617755 expression of OPG, RANK and RANKL genes exert a crucial role in the progression of avascular necrosis
26554541 Switched memory B cells from RA patients expressed significantly more RANKL compared to healthy controls. B cells supported osteoclast differentiation in vitro in a RANKL-dependent manner.
26506085 Atorvastatin treatment reduced circulating osteoprogenitor cells and RANKL expression in T cells, and increased OPG serum levels in postmenopausal osteoporisis.
26420479 IL-29 directly induces RANKL expression in rheumatoid arthritis-fibroblasts like synoviocytes via MAPK signaling pathway.
26398902 high level of mRANKL/RANK expression in cervical cancer lesions plays an important role in the rapid growth of cervical cancer cells possibly through strengthening the dialogue between cervical cancer cells and regulation of IL-8 secretion
26366858 Taken together, these results suggested that the expression of RANKL induced by TiPs was mediated by ER stress in fibroblasts.
26362732 Th17 cytokines have a dual effect on osteoclastogenesis in rheumatoid arthritis (RA): direct induction of osteoclastogenesis from monocytes and up-regulation of RANKL production in RA fibroblast-like synoviocytes (FLSs).
26351115 Alendronate stimulated OPG mRNA and protein expression, but not RANKL expression, in fibroblasts from patients with aseptic loosening following total hip arthroplasty.
26339601 qPCR and in silico hybridization revealed that miR-124 and miR-155 can be directly involved in the transcriptional regulation of Runt-related transcription factor 2 (RUNX2) and receptor activator of nuclear factor kappa-B ligand (RANKL) genes.
26337028 Data show that receptor activator of nuclear factor kappa B ligand (RANKL) was elevated in anti-citrullinated protein antibodies (ACPA)-positive and in anti-cit-vimentin-positive patients with early untreated rheumatoid arthritis (RA).
26261013 Despite comparable osteoprotegerin concentrations, lumbar disc herniation cases express lower RANKL than controls. Disc herniation was strongly associated with RANKL and the presence of the F allele of the VDR gene.
26218592 RANKL Polymorphisms Are Associated with Aromatase Inhibitor-Related Musculoskeletal Adverse Events in Breast Cancer.
26200837 Src expression showed a significantly positive linear relationship with RANK, suggesting a potential mechanism of the RANKL-RANK axis in regulating breast cancer cell differentiation and antiapoptosis.
26149648 a dual action of HDFCs in osteoclastogenesis; moreover, parathyroid hormone-related protein, CSF-1 and BMP-2 might influence osteoclastogenesis by regulating the expression of RANKL and OPG in HDFCs
26133738 Transglutaminase 2 up-regulation is associated with RANKL/OPG pathway
26112372 these findings suggest a possible mechanism underlying the RANKL expression induced by wear particles in fibroblasts, and downregulating ER stress and the XBP1s expression of fibroblasts
26090754 The athors show that osteoprotegerin, but not receptor activator for nuclear factor-kappaB ligand, is associated with subclinical coronary atherosclerosis in HIV-infected men.
26079882 PHB expression was time-dependently increased by RANKL in BMMs. However, the retroviral over-expression of PHB strongly inhibited the expression of c-Fos and NFATc1, and activation of p38-Elk-1-SRE signaling pathway
26038599 These findings suggest that RACK1 specifies the RANKL-stimulated activation of p38 MAPK by facilitating the association of MKK6 with TAK1
25912212 Serum RANKL was significantly higher in juvenile-onset anklylosing spondylitis patients than in controls. There was no significant difference in RANKL levels among patients with various HLA-B27 genotypes.
25849336 Pregnancy increases RANKL expression both in normal breast and primary tumors.
25837853 higher levels in patients with Rheumatoid Arthritis, decrease correlates with response to Methotrexate therapy and improvement
25811130 C/EBPbeta, especially C/EBPbeta-LIP in cooperation with ATF4, is involved in osteoclast formation by regulating RANKL expression in RA-FLS. These findings suggest that C/EBPbeta plays a crucial role in bone destruction in RA joints
25810067 genetic variation not associated with hypertension in Chinese women
25797915 OPG level is associated with endothelial function in rheumatoid arthritis patients and controls.
25724681 RANKL rs9533156, OPG rs2073618, and OPG rs2073617 single nucleotide polymorphisms and their serum protein levels were studied for a possible association with breast cancer development.
25667102 demonstrate, for the first time, the novel suppressive effects of QUE on RANKL-induced osteoclast differentiation in vitro and human breast cancer-induced bone loss in vivo, suggesting that QUE may be a potential therapeutic drug for osteolysis treatment
25609157 RANKL gene polymorphism is associated with vertebral fractures and bone mineral density in premenopausal systemic lupus erythematosus.
25464125 The data support an association between SNPs in the RANK/RANKL/OPG signalling pathway and the development of stress fracture injury.
25445452 TRAIL induces RANKL expression through a STAT-6 dependent transcriptional regulatory mechanism in bone marrow stromal/preosteoblast cells.
25433635 role in the interaction between basophils and dendritic cells
25412610 Progesterone mediates estrogen-induced mammary carcinogenesis through activation of GLI-1 in a RANKL-dependent manner.
25393853 The B cell RANKL/OPG ratio correlated significantly with total hip and femoral neck bone mineral density (BMD)
25375981 RANKL is highly expressed in active Langerhans cell histiocytosis at the lesional level, concomitant to p65 NFkappaB activation
25345075 Here, we will discuss the important role of RANKL and its possible role in the management of bone loss in patients with breast cancer.
25335447 Direct contact but not paracrine interactions between human metastatic breast cancer cells and bone cells has a significant effect on RANKL/OPG expression in bone metastatic cells.
25333856 High levels of RANK, RANKL and OPG expression can help to identify prostate cancer patients at high risk of developing bone metastasis.
25289668 High serum ANGPTL4 with circulating RANKL suggests that ANGPTL4 may represent a novel marker for bone destruction in rheumatoid arthritis.
25280574 We found high osteoprotogerin concentrations, increased CIMT [ carotid artery intima media thickness ] and decreased FMD [flow-mediated vasodilation], in women with PCOS [polycystic ovary syndrome].
25270538 Data show that icariin decreases the expression of osteoprotegerin (OPG), receptor activator of nuclear factor kappa-B ligand (RANKL) and receptor activator of nuclear factor kappa-B (RANK) in interleukin 1 beta-stimulated chondrocytes.
25268581 RANKL could potentiate migration and invasion ability of RANK-positive hepatocellular carcinoma cells through NF-kappaB pathway mediated epithelial-mesenchymal transition.
25212894 local and systemic involvement of sRANKL and OPG in human fracture healing.
25211367 Data suggest that the T cell control region (hTCCR) region contains a cell-selective set of enhancers that plays an integral role in the transcriptional regulation of the Rankl gene Tnfsf11 in T cells.
25200184 A highly bone metastatic RANKL-overexpressing prostate cancer cell line, LNCaP(RANKL)used as a model to study increased adhesion of prostate cancer (PCa) cells to collagens and found 3-D suspension culture and in vivo PCa tumor growth restore AR through downregulation of AP-4, enhancing integrin alpha2 expression and adhesion to ColI which is rich in bone matrices.
25138985 receptor activator of NF-kappaB ligand(RANKL)may be involved in the regulation of epiphyseal plate injury and repair in Kashin-Beck disease.
25138264 Genetic polymorphism in TNFSF11 influence bone mineral density in post-menopausal women.
25111682 High RANKL protein expression is associated with breast cancer.
25079688 RANKL contributes to glioma invasion by modulating the peripheral microenvironment of the tumor.
25068378 SNP of TNFSF11 (rs2277438) may have an important influence on bone and joint injury in rheumatoid arthritis.
25060295 Periostin and receptor activator of nuclear factor kappa-B ligand expression in allergic fungal rhinosinusitis
25056244 the OPG/RANKL ratio has a role a possible marker of progression of vascular dysfunction in diabetes
25047443 In the present study, we investigated the ability of triptolide, a diterpenoid isolated from Thunder of God Vine, to inhibit signaling by receptor activator of NF-kappaB (RANK) and its ligand (RANKL) and to modulate osteoclastogenesis
25013993 Below-knee arterial calcification severity is clearly correlated with peripheral neuropathy severity and with several usual cardiovascular risk factors, but not with serum RANKL level.
25007964 RANKL mRNA and protein expression fluctuate with serum progesterone with highest levels in the luteal phase, suggesting that RANKL is a modulator of progesterone signaling
24989131 These findings indicate that only a few transactivation domain-specific mutations within MAFB cause multicentric carpotarsal osteolysis.
24958900 RANKL-induced osteoclastogenesis is inhibited by MGF-E8 exogenously added to human osteoclast precursors.
24929185 In the present review, we summarize the multiple functions of RANKL in bone and in the immune systems, aiming to provide an overview of the field of osteoimmunology. [review]
24875904 TNFalpha in the marrow microenvironment led to RANKL demethylation and re-expression in myeloma cells through DNMT1 repression and upregulation of miR-126-3p and miR-140, both known to repress DNMT1 translation.
24827498 These data suggest that PDLSCs promote osteoclast differentiation via Runx2 upregulating RANKL and downregulating OPG, leading to enhanced root resorption that results in physiological exfoliation of primary teeth.
24780728 Data suggest that serum levels of RANKL/TNFSF11 (a biomarker of bone metabolism) can be regulated by dietary factors, here by daily ingestion of dried plums and calcium/vitamin D dietary supplements by osteopenic postmenopausal women.
24769277 Serum RANKL and OPG levels varied markedly with sexual development in adolescence. These cytokines were not predictive of bone turnover or BMD at 13, but serum RANKL bioactivity was associated with bone resorption in late adolescence
24729980 The effect of rs1054016(RANKL) adds to the evidence that the RANK pathway plays a role in BC pathogenesis and progression with respect to BMFS, emphasizing the connection between BC and bone health.
24726460 These findings demonstrate that RANKL-RANK signal activation is essential to ABC tumor progression. RANKL-targeted therapy may be an effective alternative to surgery in select ABC presentations.
24721487 Cardiovascular disease influences osteoprotegerin levels in males of late middle-age but not young elderly males.
24719884 RANKL plays a critical role in periodontal bone resorption.
24710939 IL-6R antibody could significantly increase the expression of OPG, but inhibit the expression of RANKL, which might provide a theoretical basis of molecular biology for the prevention and treatment of aseptic loosening of prosthesis.
24664887 The PTX3-driven increase in the osteoclastogenic potential of precursor osteoblasts (pOB) appears to be mediated by the effect of PTX3 on pOB RANKL production.
24574213 SDF-1 induces osteoclastogenesis directly and indirectly via up-regulating RANKL expression in rheumatoid arthritis synovial fibroblasts and CD4+ T cells, and that this is mediated by TNFalpha.
24557630 IL-17 induces the migration of neutrophils and monocytes/macrophages through the activation of synoviocytes, and enhances a positive feedback loop composed of proinflammatory cytokines IL-6 and IL-17, but not RANLK
24533935 The RANKL-mediated signalling may help develop more sophisticated cell-based therapies to inhibit calcification of the vessel wall.
24531425 Serum OPG levels were increased and correlated with serum MCP-1 levels in premenopausal systemic lupus erythematous patients.
24488413 OPG concentrations are independently associated with endothelial activation and carotid atherosclerosis in rheumatoid arthritis. OPG may be involved in increased cardiovascular disease risk and may improve its stratification in patients with RA.
24478054 RANK- and c-Met-mediated signal network promotes prostate cancer metastasis or colonization to bone.
24448976 High osteoprotegerin expression is associated with bone metastases.
24442994 SNP rs2277438 of the RANKL gene was associated with the susceptibility of AS in a Chinese Han population.
24326209 Baseline serum high sRANKL level and sRANKL/OPG ratio are associated with atrial fibrillation recurrence after primary ablation procedure in lone AF patients.
24307429 In patients with coronary artery disease serum levels of osteoprotegerin are increased compared to controls.
24296448 Reduced levels of sclerostin and increased ratio of cytokines RANKL/OPG may suggest disturbances in the balance between bone formation and bone resorption in children with cow's milk allergy.
24277958 An increase serum RANKL concentration coexisting with lower levels of OPG may be associated with intensification of bone resorption in cystic fibrosis children.
24272640 data indicate that RANKL provokes breast cancer bone metastases via two distinct, but potentially overlapping mechanisms: stimulation of tumor-associated osteoclastogenesis and stimulation of RANK-expressing tumor cells
24200492 High osteoprotegerin expression is associated with Avascular Necrosis of Femur Head.
24161214 Low doses of IGF-I constituted a real replacement therapy that normalized IGF-I serum levels improving the expression of most of these proteins closely involved in bone-forming, and reducing bone resorption
24127173 These novel huRANKL transgenic models of osteoporosis represent an important advance for understanding the pathogenesis and treatment of high-turnover bone diseases and other disease states caused by excessive RANKL.
24066029 Data found that RANKL and neuropilin-1 (NRP-1) expression predicts survival of Caucasian-Americans with PC.
24048682 These results also provide evidence that osteoprotegerin is likely to exert its pro-inflammatory effects through NF-kappaB activation.
24040204 TRAIL-deficiency accelerates vascular calcification in atherosclerosis via modulation of RANKL.
23990468 Pax6 interferes with RANKL-mediated osteoclast differentiation together with Grg6.
23971629 in this work it was shown that receptors are expressed in human PBMCs when they undergo differentiation to multinucleated osteoclastic-like cells in presence of RANK-L
23959668 Higher OPG levels in hemodialysis women comparing to age matched men indicate the necessity of more careful screening towards the presence of CVD and bone-mineral disorders.
23915851 Genotypes of these single nucleotide polymorphisms of ESR1 and RANKL may help us predict the osteoporosis risk in menopausal women.
23869610 Substance P and titanium particles acted synergistically to increase RANKL expression.
23856613 genetic polymorphism is associated with osteoporosis in Chinese postmenopausal women
23845465 Early genetic events such as the loss of RANKL and the gain of CXCR4 expressions probably facilitate the metastatic progression concomitant with the primary tumor establishment.
23762088 Impaired expression of RANKL results in a severe form of autosomal recessive osteopetrosis. (Review)
23756197 increase in receptor activator of nuclear factor kappa-light-chain-enhancer of activated B cell ligand was parallel to the generation of reactive oxygen species provoked by Cu(2+)-oxidized low density lipoprotein
23752595 Low values of the OPG/sRANKL ratio associated with high OPG and sRANKL levels suggest some defect in the mechanism compensating for bone remodeling disturbances in girls with anorexia nervosa.
23744843 Genome-wide association associated single-nucleotide polymorphisms (SNPs) near candidate genes such as RANK and RANKL suggest that these single nucleotide polymorphisms and/or other variants nearby may be involved in bone phenotype determination.
23710898 Enterococcus faecalis LTA could upregulate the expression of RANKL and OPG at different rates, suggesting a potential role for LTA in the bone resorption process of refractory apical periodontitis through the regulation of RANKL and OPG
23710436 1,25(OH)2D3 might be able to decrease damage of cartilage and bone in RA patients by regulating the expression of RANKL signaling pathway and pathway-associated cytokines.
23702841 The study prospectively evaluated levels of RANK, RANK-L and OPG transcripts in the peripheral blood of 49 consecutive patients with advanced breast, lung or prostate cancer.
23698708 Data indicate that activation of T cells induces expression of TNFSF11 Variant 2 mRNA.
23697850 RANKL/RANK signal promotes Bcl-2 and Ki67 and decreases FasL expression, and further as a positive regulator for stimulating the proliferation and growth of DSCs through up-regulating CCL2/CCR2 signal
23677868 Siglec-15 regulates osteoclast development and bone resorption by modulating receptor activator of nuclear factor kappaB ligand (RANKL) signaling in association with DAP12.
23666878 Osteoprotegerin causes apoptosis of endothelial progenitor cells by induction of oxidative stress.
23612487 These findings suggest that Sphingosine-1-phosphate activates signaling leading to nuclear translocation of beta-catenin in osteoblast-like cells and upregulation of osteoptotegerin and osteoblast differentiation markers
23600327 Report RANKL expression in cultured human middle ear cholesteatoma epithelial cells.
23549459 Maxillary sinus augmentation procedures through equine-derived biomaterial or calvaria autologous bone: immunohistochemical evaluation of OPG/RANKL in humans.
23531404 OPG and RANK but not RANKL genetic polymorphisms influence bone mineral density mainly in the femoral neck in peri- and postmenopausal Chinese women.
23521017 all lesions showed a significantly higher (P < 0.05) level of cells expressing RANKL than OPG, indicating hard tissue resorption processes where active in the lesions
23516466 Differential expression of the RANKL/RANK/OPG system is associated with bone metastasis in human non-small cell lung cancer.
23509146 These results indicate that Brucella abortus infection inhibited synoviocyte apoptosis through the upregulation of antiapoptotic factors.
23499553 RANKL produced by both stromal and cancer cells is involved in oral cancer-induced osteoclastic bone resorption.
23457386 RANKL/OPG ratio and DKK-1 expression differ in primary osteoblastic cultures from osteoarthritic and osteoporotic subjects.
23440406 Our data suggest a close correlation between higher serum levels of RANKL and OPG and the fracture healing process, indicating that RANKL and OPG are involved in fracture healing
23439434 Increased levels of CXCL5 contribute to enhanced levels of RANKL expression in Paget's disease of bone.
23437003 genetic variant in the RANKL locus influences cortical vBMD, at least partly, via effects on cortical porosity.
23404437 Different from RANKL, the VEGF serum levels were higher in gastric patients than in controls, suggesting a block of the angiogenesis inhibition due to RANKL
23396210 this study provides evidence for a role of RANKL signaling in the pathogenesis of type 2 diabetes mellitus.
23336103 Serum expression of OPG and RANKL/OPG ratio were lower and higher, respectively, in neuroendocrine tumor patients harboring bone neoplasms (BM) than in those without BM.
23329761 These findings suggested that g.23276 G>A genotypes in the OPG gene were associated with spine bone mineral density in Chinese postmenopausal women.
23267146 Our data suggest that RANK, RANKL and OPG may potentially be used as novel prognostic markers for bone metastasis and provide new therapeutic targets in the treatment of breast cancer
23244167 The RANKL rs7984870 C/G polymorphism was not associated with a risk for Rheumatoid Arthritis.
23241893 Our data indicate that RANKL also subverts NK cell immunosurveillance, which can be prevented by the clinically available RANKL Ab Denosumab, at least in RANKL-positive AML cases.
23190522 Receptor activator of nuclear factor-k B ligand/ osteoprotegerin ratio alteration in renal failure should be considered as an etiologic factor or only as a surrogate marker for renal osteodystrophy
23183242 Data suggest that inhibition of PPP2CA (protein phosphatase 2A C alpha) activity impairs osteoclastogenesis by regulating RANKL and OPG (osteoprotegerin) expression in osteoblasts.
23178378 Data indicate that both lenalidomide and pomalidomide significantly blunted RANKL upregulation normalizing the receptor activator NF-kappaB ligand (RANKL)-osteoprotegerin (OPG) ratio in osteoprogenitor cells when co-cultured with multiple myeloma cells.
23177932 The results indicate that CT genotype of rs9533156 RANKL gene polymorphism was significantly associated with peri-implantitis.
23176170 Data indicate that the GSH/GSSG redox couple affects osteoclastogenesis mainly through osteoprotegerin (OPG) down-regulation with an increase in the ratio of receptor activator of NF-kappaB ligand (RANKL) to osteoprotegerin and vice versa.
23139212 Our findings introduce Fc-optimized RANK-Ig fusion proteins as attractive tools to neutralize the detrimental function of RANKL while at the same time potently stimulating NK cell antitumor immunity.
23077504 results provide further support for the potential osteoclastogenic effects of BDNF, which may mediate stromal-MM cell interactions to upregulate RANKL secretion, in myeloma bone diseases
23018352 The present data reinforce the clinical utility of OPG in carotid atherosclerosis, whereas the clinical implication of RANKL seems uncertain.
22989723 data demonstrate the ability of OSCCs to produce RANKL, directly altering the tumor microenvironment to increase osteoclastogenesis and mediate local bone invasion
22955577 human cementoblasts in vitro express increased levels of RANKL, in particular during the combination of inflammation and compression.
22952578 soluble RANKL produced by myeloma cells causes generalised bone loss, suggesting that targeting RANKL may prevent osteoporosis in patients with myeloma
22936827 Elevated levels of the mediator of catabolic bone remodeling RANKL in the bone marrow environment link chronic heart failure with osteoporosis.
22929916 RANKL up-regulation is considered a prerequisite in virtually all conditions of cancer induced bone destruction. [Review]
22867712 Rheumatoid and pyrophosphate arthritis synovial fibroblasts induce osteoclastogenesis independently of RANKL, TNF and IL-6.
22848465 the increase in RANK-RANKL expression is a response to podocyte injury, and RANK-RANKL may be a novel receptor-ligand complex for the survival response during podocyte injury.
22753650 In hemophilic arthropathy, the synovium highly expressed RANK and RANKL, whereas OPG immunopositivity decreased, suggesting an osteoclastic activation.
22715006 Localized prostate cancer is associated with early specific changes of the RANKL pathway in serum and bone marrow.
22709525 Chondrocyte-synthesized RANKL may contribute to the development of juxta-articular osteoporosis associated with chronic arthritis
22705116 summary of recent advances in understanding osteoclastogenic signaling/osteoimmunology: RANKL/RANK/OPG signaling in osteocytes plays role in bone remodeling as seen in bone resorption or arthritis. [REVIEW]
22704876 Osteoprotegerin serum levels after myocardial infarction are independent predictors for major adverse cardiovascular events.
22698523 OPG, RANKL or TRAIL do not modify the regulation of a calcification-associated gene set.
22664871 The 2.7-A crystal structure of human RANKL trimer is reported in complex with the N-terminal fragment of human OPG containing four cysteine-rich tumor necrosis factor receptor (TNFR) homologous domains (OPG-CRD).
22640692 Serum osteoprotegerin levels are significantly correlated with arterial stiffness and with the extent of coronary artery disease.
22634178 Estradiol suppressed the adiponectin-regulated OPG/RANKL expression and then inhibited osteoclastogenesis.
22627031 Peri-implant osteolysis in early total ankle replacement implant failure seems to be caused by the RANKL-driven chronic foreign body inflammation directed against, not implant-derived particles, but against necrotic autologous tissues.
22592030 Serum concentrations of osteoprotegerin are significantly higher 6 months after surgical aortic valve replacement.
22556124 Dehydroepiandrosterone seems to act selectively on osteoblasts via the dominant ER beta receptor, which mediates amplified cell viability through the MAPK signaling pathway involving pERK1/2 and upregulates the production of OPG rather than RANKL.
22546829 Genetic variations using representative single nucleotide polymorphisms (SNPs) of OPG (rs2073618), RANK (rs1805034) and RANKL (rs2073618), were analysed.
22531921 regulated RANK expression contributes to the fine tuning of PMN migration, for example, on and through inflamed endothelium that is known to express RANKL.
22490874 The ratio of serum osteoprotegerin to RANKL at 1 year was significantly higher in in hemodialysis patients with progressing coronary artery calcification.
22402034 serum OPG concentration was significantly lower in carotid population compared to femoral population while RANK and RANKL were equally expressed in both arterial beds
22330139 c-Myc activation through CXCL13-CXCR5 signaling axis stimulates RANKL expression in stromal/preosteoblast cells. Thus, our results implicate CXCL13 as a potential therapeutic target to prevent OSCC invasion of bone/osteolysis
22326262 These findings suggest that S1P/S1P1 signaling may play an important role in RANKL expression by MH7A cells and CD4(+) T cells.
22278625 Osteoprogerin predicted a premature state of vascular calcification in asymptomatic normotensive individuals, and renal function significantly contributed to this process in both hypertensive and normotensive subjects.
22278426 Data suggest that adults with Langerhans cell histiocytosis have low serum RANKL levels and high osteoprotegerin levels compared to control subjects; in contrast to other skeletal disorders, serum Dickkopf-1 levels are not elevated above controls.
22268274 The OPG/RANKL system is significantly associated with menopausal status and could play a role in postmenopausal osteoporosis.
22242921 Studies reveal that an assembly including 3 denosumab monoclonal antibody molecules binds to 2 RANKL trimers in the most stable complex in phosphate buffered saline at 37 degrees C.
22214279 RANK, RANKL and OPG proteins are differentially expressed in periodontal tissues and may play a major role in the bone loss occurring in periodontitis
22207352 These data suggest that changes in DNA methylation contribute to regulate the expression of these genes, which are critical for bone homeostasis; however, other mechanisms independent of DNA methylation appear to be involved in the increased RANKL/OPG ratio of patients with osteoporotic fractures.
22185226 The rs2277438 SNP of the RANKL in PHPT patients was a non significant trend towards lower BMD in the 1/3 distal radius and at total hip in the minor allele homocygotes (GG) genotype group versus heterocygotes and major allele homocygotes (AA).
22178057 The RANKL/osteoprotegerin ratio was significantly higher in paroxysmal atrial fibrillation than persistent atrial fibrillation.
22176920 Radiographic emphysema is correlated with low BMD in current and former smokers with COPD. IL-1beta, IL-6, TNF-alpha, and the osteoporosis-related protein system OPG/RANK/RANKL.
22172512 RANKL induced large resorption pits (10,876 +/- 2190mum(2)) whereas TNF-alpha/IL-1 and LIGHT generated smaller pits (respectively 1328 +/- 210 and 1267 +/- 173mum(2)).
22120987 Alteration of Dickkopf-1 and receptor activator of nuclear factor-kappaB ligand during PBSC mobilization in healthy donors by G-CSF.
22119834 The significantly increased levels of sRANKL and RANKL osteoblasts in postmenopausal osteoporosis demonstrate osteoclastogenesis activation.
22116393 RANKL might have a role in coronary calcification and related cardiovascular risk
22102368 PTHrP increases RANKL expression by stromal cells from giant cell tumor of bone.
22053710 RANK-L and tumor necrosis factor (TNF)-alpha significantly increase the matrix degradation of human macrophage foam cells in degrading type I collagen, a major component of extracellular matrix in atherosclerotic plaques.
22049226 RANK expression might be an independent predictor of poor prognosis in breast cancer patients with bone metastasis, and RANK expression does not associate with the prognosis in patients with visceral metastasis.
22034880 Our data suggest that OPG through the TRAIL pathway, but not the RANKL pathway, plays a role in regulating anti-apoptosis during the development of infantile haemangioma
22027240 Age and levels of anti-Sm antibodies are independent predictors of soluble RANKL/osteoprotegerin ratio variations in systemic lupus erythematosus patients.
22025323 Cobalt and chromium ions reduce human osteoblast activity, reduce the OPG to RANKL ratio, suggesting osteolysis, and lead to oxidative stress.
22023082 The results of the present study suggest that RANKL is associated with Age at menarche in Chinese women.
22001292 AF groups had higher atrial gene expression of OPG/RANK/RANKL axis and RANKL/OPG ratio, particularly in paroxysmal AF.
22001124 Results describe the relationship between bone metabolism and OPG/RANK/sRANKL concentrations in females with anorexia nervosa.
21992185 RANKL-expressing T cells are present within gouty tophus tissues induced by pro-resorptive cytokines and illustrating the capacity and mechanism of bone destruction.
21991382 These results suggest that sclerostin may have a catabolic action through promotion of osteoclast formation and activity by osteocytes, in a RANKL-dependent manner.
21970938 Osteoprotegerinwas found to be superior to the other biomarkers studied in identifying patients with documented coronary artery disease.
21964949 No significant association was observed between RANKL SNPs and quantitative computed tomography parameters
21963155 RANKL expression and an increase in the RANKL/OPG ratio in bone marrow adipocytes were stimulated by TNF-alpha treatment.
21941412 Data suggest that RANKL and osteoprotegerin play significant roles in multiple myeloma pathophysiology, as regulators of bone turnover and mediators of angiogenesis.
21903860 Studies indicate that activation of RANK signalling by RANKL leads to expression of genes required for the fusion of mononuclear osteoclast precursors.
21880134 Expression of RANKL was found to be significantly greater in more degenerated compared to healthier discs
21868322 A rough and porous surface of the culture plates and prolonged culture time can synergistically up-regulate the ratio of OPG/RANKL mRNA.
21850548 explores relationship between circulating RNAKL and RNAKL levels in bone [review]
21814026 the central RANKL/RANK pathway has an important role for thermoregulation.(review)
21814025 It is involved in establishment of self-tolerance in thymus by regulating the development of mTECs expressing Aire and tissue restricted antigens. (review)
21814024 induced osteoclast differentiation from cell cycle-arrested quiescent osteoclast precursors. (review)
21814023 It regulates bone-resorptive functions of mature osteoclasts in vivo .
21814022 It is involved in the development of osteoclasts, cooperating with another key molecule, M-CSF.(review)
21814021 Inhibiting RANKL signaling may contribute to the suppression of myeloma expansion.(review)
21814020 It is critical to the development and progression of bone metastases in breast neoplasms. (review)
21814019 It essentially involved in pathogenesis of osteoporosis.(review)
21814018 RANKL signal promotes osteoclast differentiation through a transcriptional activation of responsible genes for osteoclast formation and functions.(review)
21814016 It stimulates osteoclasts differentiation and function and its mutation causes osteoclast abnormalities. (review)
21810381 Data found elevated serum receptor activator of nuclear factor kappa B ligand and osteoprotegerin levels in late-onset male hypogonadism.
21802729 Increased RANKL is associated with high bone turnover in a case of a CD34+/CD117+/myeloperoxidase(+dim) acute myeloid leukemia presenting with severe hypercalcemia and lumbar spine fractures.
21777519 TACE can induce RANKL expression and promote osteoclastogenesis, thus worsening the outcome of periodontitis.
21748518 Suppression of RANK and increased expression of RANKL in malignant tissue warrant further investigation.
21742767 Presented is a comprehensive reaction map of the RANKL/RANK-signaling pathway based on an extensive manual curation of the published literature.
21725611 The present study investigated the role of downstream molecules of RANKL/RANK signaling in breast cancer cells using Transwell chemotaxis assays. RANKL was shown to direct the migration of MDA-MB-231 breast cancer cells.
21708014 CXCL10 increased RANKL expression in CD4+ T cells and it was mediated by Galpha(i) subunits of CXCR3.
21692859 RANKL showed a significantly increased expression in the epidermis of skin biopsy specimens from patients with psoriasis compared to patients with cutaneous lupus erythematosus. RANKL might play an important role in the pathogenesis of psoriasis.
21649792 Serum OPG may be a useful biomarker for early diagnosis of chronic kidney disease-mineral and bone disorder.
21643971 The molecular system of RANK/RANKL/OPG is variably expressed in odontogenic keratocysts, radicular cysts, and ameloblastomas
21565793 Men with higher serum OPG concentration had lower cortical thickness and bone mineral density.
21561598 These results implicate RANKL expression causatively in tumor growth and progression in head and neck squamous cell carcinoma.
21547906 Ewing sarcoma cells do not resorb bone directly but that they may support osteoclast formation by a RANKL-dependent mechanism
21514280 hypoxia upregulates RANK and RANKL expression and increases RANKL-induced cell migration via the PI3K/Akt-HIF-1alpha pathway.
21479768 Report higher OPG levels in patients with chronic kidney disease stage 5 correlated with the levels of RANKL and FGF-23, possibly reflecting a compensatory mechanism to the negative balance of bone turnover.
21479680 results suggested that mechanisms other than the RANKL/RANK signalling pathway might be involved in the osteoclastogenic response mediated by MG63 cells
21474331 The present study aimed to comparatively investigate the effects of the Zurich in vitro supragingival and subgingival biofilm models, on RANKL and OPG gene expression in primary human gingival fibroblasts (GF) cultures.
21413932 The post-translational modifications of nuclear factor of activated T-cells c1 (NFATc1) are important for its stability and transcriptional activity and are regulated by receptor activator of NF-kappaB ligand (RANKL) during osteoclastogenesis.
21401926 The interactions among MIF, synovial fibroblasts, osteoclasts, RANKL, and IL-1beta have a close connection in osteoclastogenesis
21371424 the calcification inhibitor OPG is contained in crystallizing matrix vesicles and has a biphasic effect on VSMC: physiologic concentrations inhibit calcification, whereas high concentrations commonly seen in patients with vascular disease have no effect.
21370405 High RANKL was associated with localized, high-grade osteosarcoma
21359671 artistic gymnastic is associated not only with an increase in aBMD but also an improvement in bone geometry associated with an increase in bone remodelling. These adaptations seem to be independent of the OPG/RANKL system.
21352301 no significant association of SNPs with susceptibility to disease in psoriasis and psoriatic arthritis patients
21331661 We conclude that height loss is positively associated with OPG in men and in postmenopausal women not using HRT. No relationship was found between RANKL and height loss.
21328467 the RANKL and RANK interaction results in up regulation of ICAM-1 thereby increasing human lung cancer cell migration
21328055 Synovial fluid level of RANKL was correlated with parameters of disease activity and severity in rheumatoid arthritis and osteoarthritis patients rather than its serum level
21327765 osteoclastogenesis and RANKL expression are reduced in marrow from women taking alendronate
21327451 Serum OPG was a more reliable marker than serum RANKL in detecting bone metastatic spread and in predicting survival probability in prostate cancer patients with bone metastasis.
21326202 RANKL and RANK are involved in mammary/breast cancer metastasis
21316442 no significant changes in level with aerobic exercise or resistance training programs
21290130 Increased local and systemic levels of soluble RANKL might be indicative for osteoarthritis disorders.
21259010 Increased expression of RANKL in grade 2 osteoarthritic (OA) cartilage might explain the increase in bone turnover reported in the subchondral bone of OA patients in patients undergoing total hip/knee replacement.
21193069 number of TRAP(+) multinucleated cells that formed was in the range of 40-75% of that supported by MCSF plus RANKL
21159831 Data show that radiographic damage in patients with chronic gouty arthritis is negatively associated with serum sIL-6 receptor and osteoprotegerin.
21124946 This finding implicates RANKL as a locus containing variation associated with volumetric bone density.
21087777 Plasma levels of both osteoprotegerin and adiponectin were negatively correlated with body weight, body mass index, waist circumference, and fasting plasma insulin while being positively correlated with insulin sensitivity.
21074311 Pregnancies complicated with pre-eclampsia exhibit higher OPG levels and OPG/RANKL ratios, compared to control pregnancies, which might be compatible with lower bone turnover.
20974615 Observational study of gene-disease association. (HuGE Navigator)
20932948 RANKL was inversely related to free leptin in children with prior fracture.
20890036 Its mutation causes familial expansile osteolysis. (review)
20881963 RANKL inhibition is acting on hormone-induced mammary epithelium at early stages in tumorigenesis; the permissive contribution of progesterone to increased mammary cancer incidence is due to RANKL-dependent proliferative changes in the mammary epithelium
20869948 HIV-1 Gag reduces osteoblast function and significantly reduces the levels of BMP-2, BMP-7, osteocalcin, and RANK-L
20861651 Serum OPG may be a candidate biomarker of cardiovascular complications and poor outcome among dialysis patients.
20848544 Increased serum and fecal Osteoprotegerin is associated with Crohn's disease.
20718662 The results demonstrate a lower OPG/RANKL ratio in patients suffering from thalassemia with documented osteopenia or osteoporosis in comparison with control group and patients suffering from thalassemia without osteopenia or osteoporosis.
20690034 Serum levels of sRANKL and osteoprotegerin are increased in the ankylosing spondylitis patient and may participate in the disease process of ankylosing spondylitis.
20663885 PKA activation induces bone resorptive factors in the vasculature and that aortic SMC calcification specifically induced by PKA, is not mediated by RANKL.
20631064 Activation of RANKL pathway increases EMMPRIN in osteotropic tumor cells, in turn enhancing tumor-induced bone resorption.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554715 Observational study of gene-disease association. (HuGE Navigator)
20534768 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20533289 RANKL promoter allele might promote interaction between activated T cells and dendritic cells, predisposing to a younger age at the onset of rheumatoid arthritis in seropositive European American and African American patients.
20533289 Observational study of gene-disease association. (HuGE Navigator)
20531232 The TNFRSF11A (tumor necrosis factor receptor superfamily member 11a) and TNFSF11(RANKL) genes are associated with the age of onset of menarche and natural menopause in white women
20531232 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20506523 Results suggest that the RANKL acts through MEK/ERK, which in turn activates IKKalpha/beta and NF-kappaB, resulting in the activation of beta1 integrin and contributing to the migration of human chondrosarcoma cells.
20506157 Results indicate that RANKL expression involves the MEK/ERK pathway in multiple myeloma mesenchymal stromal cells, and that early obstruction of this path, such as that achieved with ibandronate, significantly deters RANKL protein expression.
20431232 subjects with CT/CC genotypes of the rs9594782 polymorphism had a 3.9 times higher risk of aortic calcification compared with TT genotype.
20431232 Observational study of gene-disease association. (HuGE Navigator)
20416172 The sRANKL/OPG ratio in serum of multiple myeloma bone disease patients is significantly elevated.
20412401 expression of RANKL in ameloblastoma was confirmed. Ameloblastoma cells found to induce bone marrow cells from neonatal rabbit to differentiate into osteoclasts with bone-resorption activity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20333869 There were no significant differences in OPG and RANKL serum levels or bone density results between GH-deficient and GH-sufficient children
20237496 Observational study of gene-disease association. (HuGE Navigator)
20231205 Observational study of gene-disease association. (HuGE Navigator)
20225273 study has shown that C/EBPbeta is a RANKL promoter activator in stromal cells of GCT of bone
20205168 Genetic variation in the RANKL/RANK/OPG signaling pathway influences bone turnover and bone mineral density in European men.
20205168 Observational study of gene-disease association. (HuGE Navigator)
20167120 IL-17A upregulates the receptor activator for NF-kappaB receptor on human osteoclast precursors in vitro
20157786 Disturbances in the RANKL/OPG system are more profound in the bone marrow stromal cells of multiple myeloma patients than in those of control subjects after direct contact with myeloma cell lines.
20084381 and of osteocalcin, and significantly decreased levels of osteoprotegerin tahn controls.
20066901 modulation of RANKL by VEGF165 may be one of the mechanisms responsible for the osteolytic process induced by Ewing's sarcoma cells.
20033478 possible involvement of RANKL and OPG in the activation of pathways, which regulate the repair of the periodontal tissues in periodontitides
19967657 Elevated OPG levels are associated with surrogate markers of inflammation, endothelial dysfunction, oxidative stress and cardiovascular disease in chronic kidney disease patients.
19934266 We have demonstrated associations between RANKL and OPG haplotypes and bone mineral density in postmenopausal women
19934266 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19896533 Results suggest that gene-gene interactions between RANK and OPG, and RANK and RANKL influence BMD in postmenopausal women.
19877052 SOFAT (secreted osteoclastogenic factor of activated T cells) can induce osteoblastic IL-6 production and osteoclast formation in the absence of osteoblasts or RANKL. It is insensitive to RANKL inhibitor osteoprotegerin
19847430 In rheumatoid arthritis elevated synovial tissue RANKL expression is associated with progressive joint erosion, and may be independent of the clinical response to targeted therapy.
19810098 Titanium influences phenotype and function of T-lymphocytes, resulting in activation of a CD69+ and CCR4+ T-lymphocyte population and secretion of RANK-L.
19793762 Patients with Cushing's syndrome show increased levels of osteoprotegerin serum levels that remain unchanged after recovery, despite a restoration of bone formation.
19781765 suggest that UHMWPE particles induce over-expression of RANKL, IL-6, IL-8, IP-10, MCP-1, and MIG in human periprosthetic microenvironment
19716455 Review. mechanisms that control RANKL gene expression in different osteoclast-support cells and how the study of such mechanisms may lead to a better understanding of the cellular interactions that drive normal and pathological bone resorption.
19705167 Observational study of gene-disease association. (HuGE Navigator)
19699688 Results suggest a novel pathway by which T lymphocytes contribute to bone changes, namely, via oxidized lipid enhancement of RANKL production.
19671684 NFATc3 is a downstream target of the CXCL13/CXCR5 axis to stimulate RANKL expression in oral squamous cell carcinomas cells.
19662974 The expression level of RANKL in glucocorticoid-induced necrosis of the femoral head patients was significantly higher than in the control group.
19633200 ADA-deficient SCID is associated with a specific microenvironment and bone phenotype characterized by RANKL/OPG imbalance and osteoblast insufficiency.
19556344 analysis of FGF-2 stimulation of RANK ligand expression in Paget's disease of bone
19554506 The expression of RANKL gene of nuclear factor-kappaB pathway in multiple myeloma using bone marrow aspirates obtained at diagnosis is reported.
19548455 A more extensive analysis of genetic variants of RANKL/RANK/OPG signal pathways, joint with an investigation of modulated influence of estrogens, TNF-alpha or several interleukin influencing the development of osteoporosis is necessary.
19546479 Lipopolysaccharide (LPS), a toll-like receptor 4 ligand, up-regulated the expression of membrane RANKL in human blood neutrophils and murine air pouch-derived neutrophils.
19502537 Regarding the SNPs of osteoprotegerin G1181C, we found a significant linkage between the G allele and Charcot neuroarthropathy
19473572 Human annulus fibrosus in a herniated disc contained RANKL (receptor activator of nuclear factor kappa B ligand)
19458885 In summary, our findings suggest that the RANKL gene may play an important role in variation in fCSI, independent of fBMD and non-fBMD components.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19449178 analysis of competitive regulation of osteoprotegerin synthesis and RANKL expression in normal human osteoblasts stimulated by the application of cyclic tensile strain
19446344 TLR-3 enhances osteoclastogenesis through upregulation of RANKL expression in synoviocytes of patients with rheumatoid arthritis
19416721 The binding affinity of RANKL for RANK was measured with surface plasmon resonance technology and K(D) value is about 1.09 x 10(-10) M.
19415676 S100 treatment increased expression of RAGE by the MC3T3-E1 cells.
19401376 21-hydroxylase deficiency patients had higher soluble RANKL and lower OPG serum levels compared with controls.
19379170 PTH favors RANKL and inhibits OPG production in the serum of hemodialysis patients in a low turnover state; positive correlation between serum OPG and iPTH in normal or high turnover rates implies a homeostatic mechanism to limit bone resorption
19352306 Examine contributions of osteoprotegerin and RANKL to the pathogenesis of osteoporosis in patients with thalassaemia major.
19325145 Osteoprotegerin and soluble receptor activator of nuclear factor-kappaB ligand and risk for coronary events: a nested case-control approach in the prospective EPIC-Norfolk population study 1993-2003.
19299513 Trolox prevents osteoclast formation and bone loss by inhibiting both RANKL induction in osteoblasts and c-Fos expression in osteoclast precursors.
19299182 Observational study of gene-disease association. (HuGE Navigator)
19298221 Interleukin-1alpha and Porphyromonas endodontalis may be involved in developing apical periodontitis through the stimulation of RANKL production
19190327 Zerumbone is an effective blocker of RANKL-induced NF-kappaB activation and of osteoclastogenesis induced by RANKL and tumor cells, and may be a therapeutic agent for osteoporosis and cancer-associated bone loss.
19185505 Key role of RANKL in the pathophysiology of several bone diseases.
19170075 Prostate cancer cells secrete factors, including IL-6 and IL-8, that play an important role in osteoclast fusion by a RANKL-independent mechanism
19158438 The OPG level provides a good predictor of osteoporosis as well as NTx in elderly women; additionally, the findings suggest that OPG might protect elderly women from bone loss or fractures.
19134349 Calcitriol can increase RANKL mRNA expression level in human periodontal ligament cells.
19131500 results support the involvement of gene-gene interactions between the vitamin D receptor, osteoprotegerin and TNFSF11 genes in the BMD regulation, particularly in osteoporotic and non-osteoporotic post-menopausal women
19131500 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19112497 analysis of TRAF6 autoubiquitination-independent activation of the NFkappaB and MAPK pathways in response to IL-1 and RANKL
19105036 OPG is a positive regulator of microvessel formation, while RANKL is an angiogenic inhibitor due to effects on regulation of endothelial cell proliferation, apoptosis, and signaling.
19085839 RANKL/RANK have roles in bone-associated tumors (review)
19073256 The greater bone loss that characterizes OP patients can be mediated due to differences in the secretion and expression of the RANKL/OPG system in response to different stimuli.
19058836 breast cancer cell produce a sufficient amount of osteoprotegerin to bind TRAIL, resulting in an upregulation of receptor activator factor kappa B ligand (RANKL) expression
19058084 Basal expression of RANKL on the cell surface, and in co-culture with human osteoblast-like cells the number of cells expressing RANKL was increased between 2.5 and 4 times.
19008470 Based on their role in atherogenesis, this enhanced expression of RANKL and RANK could contribute to the increased risk of cardiovascular disease in hyperhomocystinemia.
18976975 Knockdown of tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18928898 might locally modulate [odontogenic tumor-associated bone resorption
18802807 Active polyarticular juvenile idiopathic arthritis with bone erosions is associated with high serum levels of RANKL and a low OPG/RANKL ratio.
18767923 lamin A/C is essential for proper RANKL-dependent osteoblastogenesis
18754324 Cytolethal distending toxin enhances RANKL expression in T-cells, denoting that these cells are a potential target for the toxin and strengthening the potential link between this virulence factor and mechanisms associated with localized bone resorption.
18727653 RANKL levels appeared to be greater in the smokers with chronic periodontitis than in non-smokers with chronic periodontitis.
18710934 These results show a new molecular cross talk between Notch and NF-kappaB pathways that is relevant in osteoclastogenesis.
18668542 Synovial fibroblasts may significantly contribute to bone resorption through modulation of RANKL and OPG production in a cytokine-rich milieu of inflamed joints.
18645583 Our results indicate that RANKL is a novel marker for EMT during prostate cancer progression. RANKL may function as a link between EMT, bone turnover, and prostate cancer skeletal metastasis.
18634923 mRNA expression was higher in periapical granulomas when compared with healthy periodontal ligament
18617513 The RING domain and first zinc finger of TRAF6 coordinate signaling by interleukin-1, lipopolysaccharide, and RANKL
18606662 These data indicate a key role for the RANKL system in the regulation of Langerhans cells (LC) survival within the skin and suggest a regulatory role for keratinocytes in the maintenance of epidermal LC homeostasis
18589796 The overexpression of RANKL and the increased ratio of RANKL/OPG in cholesteatoma are associated with the destruction of bone.
18586671 TSG-6 has dual roles in bone remodeling: it inhibits RANKL-induced bone erosion in inflammatory diseases, and its interactions with BMP-2 and RANKL help to balance mineralization by osteoblasts and bone resorption by osteoclasts
18565252 OPG and RANKL levels, and consequently the OPG/RANKL ratio, differed according to human osteoarthritis subchondral bone osteoblast classification
18565244 The high RANKL:OPG ratio, together with close fibroblast-to-monocyte contacts in pannus tissue, probably favor local generation of bone resorbing osteoclasts at the site of erosion in rheumatoid arthritis
18556224 This study thus investigated the effects of PRL on the osteoblast functions and the RANKL/OPG ratio in human fetal osteoblast (hFOB) cells which strongly expressed PRL receptors.
18539107 The level of membranous RANKL, comparing L- and H-OA {level of PGE2 [low (L) or high (H)]}, subchondral bone osteoblasts, as well as its modulation by osteotropic factors, was investigated.
18528653 increases in IL-6, MMP-13, and RANKL (receptor activator of nuclear factor kappa B ligand)expression in osteoarthritis (OA) subchondral bone osteocytes suggest that in subchondral bone OA progression involves abnormal osseous tissue remodeling.
18502820 In postmenopausal osteoporosis, TNFSF11 gene promoter polymorphisms -290C>T, -643C>T and -693G>C play a functional role in the genetic regulation of bone mineral density.
18502820 Observational study of gene-disease association. (HuGE Navigator)
18480302 A higher expression of RANKL in bone tissue suggests that increased bone resorption in patients with idiopathic hypercalciuria is mediated by receptor activator of nuclear factor kappaB ligand.
18445777 We have discovered common sequence variants that are consistently associated with bone mineral density and with low-trauma fractures in three populations of European descent.
18445777 Observational study of gene-disease association. (HuGE Navigator)
18435789 Peripheral blood mononuclear cells from periodontitis patients did not require supplementation of M-CSF or M-CSF/RANKL for the formation of osteoclast-like cells; in controls, addition of these cytokines was needed.
18406448 expression of RANKL promotes osteoclastogenesis in the breast adenocarcinoma MCF-7 cell line
18399769 serum osteoprotegerin and RANKL levels are affected by recombinant TSH
18389210 RANKL-mediated osteoclastic resorption occurs in acute Charcot's osteoarthropathy. However, the incomplete inhibition of RANKL after addition of osteoprogegerin may suggests existence of a RANKL-independent pathway.
18381203 These results suggest that E2F1 plays an important role in regulating RANKL transcription through binding to the E2F consensus binding site.
18369625 surface and intracellular RANKL production is differentially regulated on T cells of patients with ankylosing spondylitis
18367263 Data reveals for the first time that OPG/RANK/RANKL are expressed in the pathological thyroid gland by follicular cells, by malignant parafollicular cells as well as in metastatic lymph node microenvironment.
18362509 The increase in circulating free sRANKL may reflect directly or indirectly the conditions coexistent with bone loss in post-menopausal women.
18361931 no significant associations were observed with disease stages, disease status, osteolytic lesions, and survival of patients with multiple myeloma
18319315 Serum OPG and RANKL do not account for the observed association between bone and coronary artery calcification among postmenopausal women using hormone therapy.
18311801 The relative protection against bone erosions in spondylarthritis cannot be explained by qualitative or quantitative differences in the synovial expression of RANKL, OPG, and RANK.
18305214 bone marrow sera from 21 multiple myeloma patients significantly suppressed Wnt3a-induced OPG expression and enhanced RANKL expression in osteoblasts in a DKK1-dependent manner
18301383 human monocyte-derived multipotential cells derived from circulating monocytes can express RANKL and differentiate into functional osteoclasts without RANKL-expressing accessory cells
18298349 serum OPG, RANKL, MMP-1 and TIMP-1 may have roles in mediating myocardial healing after myocardial infarct
18271850 Testosterone association with serum RANKL levels in male Hhemodialysis patients suggests that RANKL may mediate the effect of testosterone on bone metabolism in these patients.
18253488 the ratio of RANKL/OPG gene expression - a key factor of osteoclastogenesis- is mediated by the cAMP/PKA/CREB pathway by suppressing leptin
18208894 increased RANKL and osteoprotegerin in multiple sclerosis may compensate for negative balance of bone remodeling
18174230 Observational study of gene-disease association. (HuGE Navigator)
18172654 The aim of this study was to investigate sRANKL and OPG levels in serum and synovial fluid (SF) and to evaluate their relations in patients with RA in comparison to those with non-erosive arthritis (NEA).
18160010 HIV-1 Gag reduces osteoblast function and significantly reduces the levels of BMP-2, BMP-7, osteocalcin, and RANK-L
18073309 circulating sRANKL did not correlate with PTH but did correlate with markers of bone resorption suggests that skeletal responsiveness to PTH may differ in this disease.
18072013 Study showed that serum levels of free RANKL and total RANKL decrease with age, and also reveals some gender-related differences.
18064531 One mechanism by which RANKL inhibition reduced tumor burden appears to be indirect through inhibition of the "vicious cycle" and involved an increase in tumor cell apoptosis.
18061491 differences in the RANK, RANKL, and OPG expression in odontogenic epithelial tumors...could contribute to the differential bone/tooth resorption activity in these lesions
17993768 Lower values of sRANKL/OPG ratio in hemodialysis (HD) patients cannot be explained by the elimination of renal clearance only. Alterations in sRANKL/OPG ratio might reflect a compensatory mechanism to modulate bone remodeling.
17990294 cAMP/PKA signaling activates the canonical Wnt pathway through the inactivation of GSK-3beta, whereas Wnt signaling might inhibit bone resorption through a negative impact on RANKL expression in osteoblasts.
17982618 Involvement of this protein in osteosarcoma biology and capability to identify novel therapeutic approaches targeting RANK-positive osteosarcomas.
17970704 OPG-RANKL system is involved in the pathogenesis and regulation of bone turnover in CRF. Circulating levels of OPG and RANKL may be useful markers to assess turnover renal osteopathies
17966895 The OPG/RANKL/RANK system constitutes the important element of controlling the number of active osteoclasts by the osteoblasts.
17895323 RANK/RANKL/OPG system mediates the effects of calciotropic hormones and, consequently, alterations in their ratio are key in the development of several clinical conditions--REVIEW
17891780 DACH1 plays an important role in negative regulation of RANKL gene expression in marrow stromal/preosteoblast cells in the bone microenvironment.
17881498 Results demonstrate the specificity of RGS10A as a key component in the RANKL-evoked signaling pathway for osteoclast differentiation.
17876645 Observational study of gene-disease association. (HuGE Navigator)
17876645 SNPs in RANKL and IL-17 may be associated with radiographic progression in Japanese patients with early RA.
17852826 Reference intervals were established with a high analytic performance for OPN and an acceptable analytic performance for OPG and total sRANKL. The study revealed low biological variation for OPN and total sRANKL and high biological variation for hsCRP.
17703334 The median level of RANKL (receptor activator of nuclear factor kappa B ligand) was elevated in Juvenile Idiopathic Arthritis (JIA) patients as compared to controls; there was no diference in levels among different types of JLA
17702740 Data suggest that OPG can bind both to RANKL and TRAIL and that the affinity of OPG for these two ligands is of a similar order of magnitude.
17667143 OPG gene G1181C polymorphism, alone and in combination with the RANKL rs2277438 polymorphism, was identified as a genetic factor associated with bone mineral density of the lumbar spine in Korean women
17634142 Review highlights the discovery of receptor activator of nuclear factor-kappa B ligand (RANKL) as a pivotal regulator of osteoclast activity and how its inhibition provides a new therapeutic target in osteoporosis.
17634140 Review highlights the receptor activator of nuclear factor-kappa B ligand (RANKL)/RANK/osteoprotegerin (OPG) system and its role in the regulation of bone resorption.
17632511 Study reports mutations in the gene encoding RANKL (receptor activator of nuclear factor-KB ligand) in six individuals with autosomal recessive osteopetrosis whose bone biopsy specimens lacked osteoclasts.
17620507 Baseline serum level of RANKL is a highly significant predictor of risk for cardiovascular disease.
17606458 expression of OPG and RANKL were significantly increased in advanced clinical stages and high grade myeloma bone disease
17593489 Dual opposing functions for RANKL signaling are highlighted in this review: the negative regulatory mechanism(s) for osteoclastogenesis, and the induction of bone resorption upon stimulation of the RANKL signaling cascade.
17580719 The expression levels of RANKL and RANK were markedly increased in the perimatrix of cholesteatoma.
17572386 These data establish a signaling cascade in which regulated Lys63-linked TRAF6 auto-ubiquitination is the critical upstream mediator of osteoclast differentiation.
17560137 no correlations between expression in any cell type and the severity of arthroscopic features [of temporomandibular joint disease]
17558893 The OPG/RANKL ratio was significantly decreased in anorectic girls; it was due to an increase in serum RANKL values. The decrease in the OPG/RANKL ratio in girls with AN could partly explain the increase in bone loss that occurs in these patients.
17520299 These findings mean that the imbalance and the disturbed interaction of RANKL and osteoprotegerin may be an important cause and pathogenesis in reduced bone mineral density in adolescent idiopathic scoliosis.
17506059 RNKL modulates expression of genes controlling survival/apoptosis/proliferation in differentiating osteoclasts.
17448630 P. gingivalis up-regulates the RANKL/OPG expression ratio in GF and PDL cells, denoting an enhanced osteoclastogenic potential by the cells.
17331078 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17328075 Children with juvenile DM have an elevated RANKL:OPG ratio at the time of diagnosis, resulting in expansion of the number of osteoclasts and activation of the bone resorptive function.
17328065 Kinin B1 and B2 receptors synergistically potentiate IL-1- and TNFalpha-induced PG biosynthesis in osteoblasts by a mechanism involving increased levels of COX-2, resulting in increased RANKL.
17288531 This review describes the most recent knowledge on the OPG-receptor activator of nuclear factor-kappaB (RANK)-RANK ligand (RANKL) triad and its involvement in bone oncology.
17197168 RANKL gene is regulated via multiple enhancers
17195907 High receptor activator of nuclear factor-kappaB ligand is associated with hepatocellular carcinoma with bone metastasis
17151927 analysis of RANKL-dependent and RANKL-independent mechanisms of macrophage-osteoclast differentiation in breast cancer
17133360 Our results add new insight to the important role of the CCL20/CCR6, RANKL system in the bone tissue of rheumatoid arthritis.
17053039 activation of RankL gene expression by PKA- and gp130-inducers is mediated via common regulatory domains that also served to facilitate the activity of 1,25-(OH)2D3
17042716 RGS12 is essential for the terminal differentiation of osteoclasts induced by RANKL.
17018528 RANKL shedding is an important process that down-regulates local osteoclastogenesis
16969487 RANKL expressed in gastric cancer may play a critical role in the promotion of osteoclast format
16953816 Observational study of gene-disease association. (HuGE Navigator)
16925460 In periprosthetic osteolysis RANKL is present only in tissues with a large amount of wear debris and predominantly in cases involving loosened cemented implants.
16861684 IL-10 significantly decreased RANKL+ Th1-associated alveolar bone loss. Thus, there are critical cytokine interactions linking hIFN-gamma+ Th1 cells to RANKL-RANK/OPG signaling for periodontal osteoclastogenesis in vivo.
16730419 Observational study of gene-disease association. (HuGE Navigator)
16730419 Our results of preliminary clinical evaluation suggest that the -290C>T polymorphism in the TNFSF11 gene promoter could contribute to the genetic regulation of BMD.
16704959 Sickle cell/beta-thalassemiapatients may develop osteopenia/osteoporosis mainly due to marrow expansion, in which RANKL may be involved.
16700737 involved in bone loss associated with periapical lesions
16681444 RANKL in mast cells may play a role in atherosclerosis
16612568 Data show that substance P stimulates production of prostaglandin E2 and receptor activator of nuclear factor- B ligand, and promotes bone resorption.
16583245 Observational study of gene-disease association. (HuGE Navigator)
16572175 the cytokine RANKL (receptor activator of NF-kappaB ligand) triggers migration of human epithelial cancer cells and melanoma cells that express the receptor RANK
16533764 Up-regulation of RANK ligand is associated with osteosarcome
16522681 Wnt signalling in osteoblasts regulates expression of RANKL and inhibits osteoclastogenesis in vitro.
16317958 Osteoclastogenesis induced by Leukotriene B4 were dose-dependently increased and weaker than that of RANKL
16270354 By upregulating IL-8, the RANKL/RANK system may contribute to the pathogenesis of B chronic lymphocytic leukemia.
16249885 Observational study of gene-disease association. (HuGE Navigator)
16240334 we review the etiology of inflammatory bone loss, the RANK/RANK-ligand/OPG pathway, and the clinical development of anti-RANK-ligand therapy.
16234249 deltaCAPRI regulates RANKL shedding by modulating MMP14 expression through Ras signaling cascades other than the Erk pathway
16220542 Expression of RANKL in interferon-gamma-producing human T cells induces osteoclastogenesis from monocytes.
16215261 OPG dimer formation is required for the mechanism of inhibition of the RANK-L/RANK receptor interaction
16191370 Active vascular epithelial cells contribute to the formation of multinucleated giant cells through regulating RANKL.
16144909 Coexpression of RANKL and VEGF is associated with osteoclastic bone destruction and tumor expansion in bone
16143421 CLD (chronic liver disease) is associated with alterations in RANKL/OPG serum levels, which could modulate bone loss in CLD.
16133687 biological responses of OPG and sRANKL synthesis in osteoblasts to the application of cyclic tensile strain are regulated via the p38 MAPK pathway
16109714 analysis of a positive feedback circuit of TRANCE-induced activation of NFATc1, involving NFATc1-mediated OSCAR expression and its subsequent activation of NFATc1, necessary for efficient differentiation of osteoclasts
16052586 Involvement of RANK/RANKL in dendritic cell-T cell interactions during inflammatory process. RANK expression appears to be limited to sites of immune reaction, both in synovium and in lymph nodes.
15972386 simultaneous inhibition of RANKL and TNF-alpha is necessary to reduce acid-induced, cell-mediated net Ca efflux from bone
15794927 megakaryocytes have direct effects on osteoblastic production of factors (RANKL) affecting both bone formation and resorption
15732858 significantly increased in periodontal disease, supporting its role in the alveolar bone loss developed in this disease
15731115 reactive oxygen species stimulate RANKL expression via ERKs and the PKA-CREB pathway
15722361 When RANKL signaling through NFATc1 was blocked with cyclosporin A, both MCP-1 and RANTES expression was down-regulated
15710592 human myeloma cells do not express significant levels of RANKL mRNA or produce RANKL able to stimulate osteoclast formation
15671541 RANKL has a role in breast carcinoma metastasis
15615497 disruption of the RANKL-RANK axis with OPG inhibited tumor-induced osteoclastogenesis and decreased bone cancer pain
15615493 Activating mutations in TNFRSF11A encoding RANK and deactivating mutations in TNFRSF11B encoding OPG cause systemic bone disease
15613999 may play a role in apical periodontitis-induced bone resorption
15564564 Review. The RANKL/RANK/OPG system may mediate links between the vascular, skeletal, & immune systems and play a central role in regulating the vascular calcification coincident with declines in skeletal mineralization with age, osteoporosis, or disease.
15554353 Parathyroid hormone [PTH (1-34)] induced RANKL messenger ribonucleic acid (mRNA) expression in cultured normal human osteoblast-like cells (hOB).
15476205 Observational study of gene-disease association. (HuGE Navigator)
15449141 HIV-1 Gag reduces osteoblast function and significantly reduces the levels of BMP-2, BMP-7, osteocalcin, and RANK-L
15377473 RANKL treatment induced a significant increase of IL-6 & IL-11 secretion by both bone marrow stromal & endothelial cells.
15322748 (RANK-L)/osteoprotegerin (OPG) signalling pathway is central to the processes regulating bone turnover in a wide variety of medical conditions, including diabetic neuropathy (review)
15320903 HIV-1 Gag reduces osteoblast function and significantly reduces the levels of BMP-2, BMP-7, osteocalcin, and RANK-L
15313187 Thus, the RANKL/OPG ratio was markedly increased, suggesting a potential mechanism of ATRA-induced bone resorption.
15304486 RANKL-induced cathepsin K gene expression is cooperatively regulated by the combination of the transcription factors and p38 MAP kinase in a gradual manner.
15292354 Enhanced apoptosis adjacent to vascular calcification and concurrent expression of regulators of apoptosis and osteoclastic differentiation, TNF-related apoptosis-inducing ligand and OPG. May be involved in pathogenesis of vascular calcification.
15290725 Since RANK-L and OPG mRNA levels are elevated in peripheral blood monocytes in rheumatoid arthritis(RA) and CD4+ T cells are major contributors to RANK-L mRNA expression, monocytes in RA may be involved in pathways regulating bone metabolism.
15221493 in-situ involvement of RANKL in both osteoclastogenesis and osteoclastic bone resorptive events occurring in prosthetic joint loosening
15205949 RANKL mRNA could be detected in bone marrow plasma cells from myeloma patients with osteolytic myeloma bone disease
15044512 specimens of ameloblastomas, dentigerous cysts, odontogenic keratocysts, and radicular cysts were subjected to immunohistochemical analysis for RANKL and tartrate-resistant acid phosphatase (TRAP).
14751235 induces osteoclastogenesis by binding with the receptor, receptor activator of nuclear factor-kappaB in the presence of macrophage colony-stimulating factor
14734048 RANKL-OPG pathway may regulate valvular calcification in calcific aortic stenosis
14699143 RANKL gene expression in the bone microenvironment is regulated by HSF2
12975380 RANKL has a role in regulation of osteoclastogenesis mediated by HIV gp120
12975380 HIV-1 Gag reduces osteoblast function and significantly reduces the levels of BMP-2, BMP-7, osteocalcin, and RANK-L
12954625 ICAM1 and RANKL are induced by Beta1 integrin/focal adhesion kinase on osteoblasts and in osteoclast maturation
12923331 osteoprotegerin and RANK ligand have roles in breast cancer bone metastasis
12824189 endothelial nitric-oxide synthase and receptor activator of nuclear kappa B ligand expression are regulated via ERK1/2 MAPK after mechanical stress
12817763 Vitamin D upregulated the expression of RANKL mRNA preferentially in cultured osteoblasts.
12756027 the first case of Follicular Lymphoma with bone involvement displaying an aberrant expression of RANKL in malignant cells
12702561 Receptor activator of nuclear factor kappaB ligand plays a nonredundant role in doxorubicin-induced apoptosis.
12698202 RANKL-induced osteoclast formation and matrix metalloproteinase dependent matrix degradation are associated with osteolysis because of bone metastasis of breast cancer.
12619938 examination as indices of bone turnover in different bone diseases
12574344 RANKL can induce maturation of monocyte-derived dendritic cells and elicit sustained antiviral cytotoxic T lymphocyte responses, either alone or cooperatively with TNF-alpha or CD40L.
12564836 REVIEW: role of these molecules in immunology and skeletal remodelling and assess their involvement in diseases of bones and joints, including rheumatoid arthritis, Paget's disease, post-menopausal osteoporosis and malignant bone diseases
12469211 compared the gene expression of RANKL and osteoprogerin in periodontitis and healthy subjects; data suggest up regulation of RANKL in inflammatory cells and epithelium may be associated with activation of osteoclastic bone destruction in periodontitis
12393684 Human myeloma cell lines increased the expression & secretion of RANKL in activated T-celes & MM cells stimulated RANKL production in autologous T-cells. This confirms the critical role of RANKL in MM bone disease.
12393586 Long-lived immature dendritic cells mediated by TRANCE-RANK interaction
12364326 stimulation by parathyroid hormone
12043011 immunohistochemical localization of RANK and its ligand (this protein) in human deciduous teeth
11792569 Macrophage colony-stimulating factor and receptor activator NF-kappaB ligand fail to rescue osteoclast-poor human malignant infantile osteopetrosis in vitro.
11741951 TRANCE stimulated DNA synthesis, chemotactic motility, and capillary-like tube formation in primary cultured human umbilical vein endothelial cells (HUVECs)
11606048 RANKL induces formation of avian osteoclasts from macrophages but not from macrophage polykaryons.

AA Sequence

MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYF      1 - 70
RAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHI     71 - 140
RAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQ    141 - 210
DGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGF    211 - 280
FKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID                                     281 - 317
//

Text Mined References (496)

PMID Year Title
26975539 2016 Plasma osteoprotegerin levels are inversely associated with nonalcoholic fatty liver disease in patients with type 2 diabetes: A case-control study in China.
26894886 2015 The Impact of Mast Cell Density on the Progression of Bone Disease in Multiple Myeloma Patients.
26722486 2015 Effect of hypoxia on the expression of RANKL/OPG in human periodontal ligament cells in vitro.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26635910 2016 Higher Urinary Levels of 8-Hydroxy-2'-deoxyguanosine Are Associated with a Worse RANKL/OPG Ratio in Postmenopausal Women with Osteopenia.
26629528 2015 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-?B Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers.
26621504 2016 CXCL16 upregulates RANKL expression in rheumatoid arthritis synovial fibroblasts through the JAK2/STAT3 and p38/MAPK signaling pathway.
26617755 2015 Expression of osteoprotegerin, RNAK and RANKL genes in femoral head avascular necrosis and related signaling pathway.
26554541 2016 Production of RANKL by Memory B Cells: A Link Between B Cells and Bone Erosion in Rheumatoid Arthritis.
26506085 2016 Atorvastatin Reduces Circulating Osteoprogenitor Cells and T-Cell RANKL Expression in Osteoporotic Women: Implications for the Bone-Vascular Axis.
26420479 2015 Interleukin-29 induces receptor activator of NF-?B ligand expression in fibroblast-like synoviocytes via MAPK signaling pathways.
26398902 2015 RANKL/RANK interaction promotes the growth of cervical cancer cells by strengthening the dialogue between cervical cancer cells and regulation of IL-8 secretion.
26366858 2015 ER Stress Mediates TiAl6V4 Particle-Induced Peri-Implant Osteolysis by Promoting RANKL Expression in Fibroblasts.
26362732 2015 Th17 cytokines regulate osteoclastogenesis in rheumatoid arthritis.
26351115 Alendronate stimulates osteoprotegerin expression in fibroblasts from periprosthetic membrane.
26339601 2015 Noncoding RNAs: Possible Players in the Development of Fluorosis.
26337028 2015 Serum RANKL levels associate with anti- citrullinated protein antibodies in early untreated rheumatoid arthritis and are modulated following methotrexate.
26261013 2016 Interplay between low plasma RANKL and VDR-FokI polymorphism in lumbar disc herniation independently from age, body mass, and environmental factors: a case-control study in the Italian population.
26218592 2015 RANKL and OPG Polymorphisms Are Associated with Aromatase Inhibitor-Related Musculoskeletal Adverse Events in Chinese Han Breast Cancer Patients.
26200837 2016 The RANK Pathway in Advanced Breast Cancer: Does Src Play a Role?
26149648 2015 Regulation of OPG and RANKL expressed by human dental follicle cells in osteoclastogenesis.
26133738 2015 Transglutaminase 2 up-regulation is associated with RANKL/OPG pathway in cultured HPDL cells and THP-1-differentiated macrophages.
26112372 2015 The fibroblast expression of RANKL in CoCrMo-particle-induced osteolysis is mediated by ER stress and XBP1s.
26090754 2015 Osteoprotegerin, but Not Receptor Activator for Nuclear Factor-?B Ligand, is Associated With Subclinical Coronary Atherosclerosis in HIV-Infected Men.
26079882 2015 Overexpression of prohibitin-1 inhibits RANKL-induced activation of p38-Elk-1-SRE signaling axis blocking MKK6 activity.
26038599 2015 The scaffold protein RACK1 mediates the RANKL-dependent activation of p38 MAPK in osteoclast precursors.
25912212 2015 Changes of serum levels of MMP-3, sRANKL, and OPG in juvenile-onset ankylosing spondylitis patients carrying different HLA-B27 subtypes.
25849336 2015 RANK-ligand (RANKL) expression in young breast cancer patients and during pregnancy.
25837853 2015 Assessment of the Effect of Methotrexate Therapy on Bone Metabolism in Patients with Rheumatoid Arthritis.
25811130 2015 CCAAT/enhancer-binding protein ? promotes receptor activator of nuclear factor-kappa-B ligand (RANKL) expression and osteoclast formation in the synovium in rheumatoid arthritis.
25810067 2015 Association of gene polymorphisms in RANKL/RANK/OPG system with hypertension and blood pressure in Chinese women.
25797915 Relationship between endothelial dysfunction and osteoprotegerin, vitamin D, and bone mineral density in patients with rheumatoid arthritis.
25724681 2015 The association between RANKL and Osteoprotegerin gene polymorphisms with breast cancer.
25667102 2015 Quetiapine inhibits osteoclastogenesis and prevents human breast cancer-induced bone loss through suppression of the RANKL-mediated MAPK and NF-?B signaling pathways.
25609157 2015 RANKL and OPG gene polymorphisms: associations with vertebral fractures and bone mineral density in premenopausal systemic lupus erythematosus.
25464125 2015 RANK/RANKL/OPG pathway: genetic associations with stress fracture period prevalence in elite athletes.
25445452 2015 STAT-6 mediates TRAIL induced RANK ligand expression in stromal/preosteoblast cells.
25433635 2015 Receptor activating NF-?B ligand (RANKL) is a constitutive intracellular protein in resting human basophils and is strongly induced on their surface by interleukin 3.
25412610 2015 Receptor activator for nuclear factor-?B ligand signaling promotes progesterone-mediated estrogen-induced mammary carcinogenesis.
25393853 2014 Dysregulated B cell expression of RANKL and OPG correlates with loss of bone mineral density in HIV infection.
25375981 2015 Rationale for the application of RANKL inhibition in the treatment of Langerhans cell histiocytosis.
25345075 2014 Targeting RANKL in the management of bone loss in patient with breast cancer.
25335447 2014 Direct but not indirect co-culture with osteogenically differentiated human bone marrow stromal cells increases RANKL/OPG ratio in human breast cancer cells generating bone metastases.
25333856 2014 Potential role of the OPG/RANK/RANKL axis in prostate cancer invasion and bone metastasis.
25289668 2014 Angiopoietin-like 4 is over-expressed in rheumatoid arthritis patients: association with pathological bone resorption.
25280574 2015 No relationship between osteoprotegerin concentrations and endothelial dysfunction in non-obese women with and without polycystic ovary syndrome.
25270538 2014 Effects of icariin on the regulation of the OPG-RANKL-RANK system are mediated through the MAPK pathways in IL-1?-stimulated human SW1353 chondrosarcoma cells.
25268581 2014 RANKL promotes migration and invasion of hepatocellular carcinoma cells via NF-?B-mediated epithelial-mesenchymal transition.
25212894 2014 Are OPG and RANKL involved in human fracture healing?
25211367 2015 Transcriptional regulation of the human TNFSF11 gene in T cells via a cell type-selective set of distal enhancers.
25200184 2014 Induction of integrin ?2 in a highly bone metastatic human prostate cancer cell line: roles of RANKL and AR under three-dimensional suspension culture.
25138985 2014 Serum levels of M-CSF, RANKL and OPG in rats fed with Kashin-Beck disease-affected diet.
25138264 2015 Polymorphisms in genes in the RANKL/RANK/OPG pathway are associated with bone mineral density at different skeletal sites in post-menopausal women.
25111682 2014 Expression of receptor activator of nuclear factor kappa-B as a poor prognostic marker in breast cancer.
25079688 2014 Tumoral RANKL activates astrocytes that promote glioma cell invasion through cytokine signaling.
25068378 Single nucleotide polymorphism of RANKL and OPG genes may play a role in bone and joint injury in rheumatoid arthritis.
25060295 2014 Periostin and receptor activator of nuclear factor ?-B ligand expression in allergic fungal rhinosinusitis.
25056244 2014 Relationships between osteoprotegerin, receptor activator of the nuclear factor kB ligand and serum levels and carotid intima-media thickness in patients with type 2 diabetes mellitus.
25047443 2014 Triptolide, a diterpene, inhibits osteoclastogenesis, induced by RANKL signaling and human cancer cells.
25013993 2014 Below-knee arterial calcification in type 2 diabetes: association with receptor activator of nuclear factor ?B ligand, osteoprotegerin, and neuropathy.
25007964 2014 RANKL expression in normal and malignant breast tissue responds to progesterone and is up-regulated during the luteal phase.
24989131 2014 Multicentric carpotarsal osteolysis syndrome is caused by only a few domain-specific mutations in MAFB, a negative regulator of RANKL-induced osteoclastogenesis.
24958900 2014 Regulation of osteoclast homeostasis and inflammatory bone loss by MFG-E8.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24929185 2014 The immune system, bone and RANKL.
24875904 2014 RANKL expression in myeloma cells is regulated by a network involving RANKL promoter methylation, DNMT1, microRNA and TNF? in the microenvironment.
24827498 2014 Periodontal ligament stem cells modulate root resorption of human primary teeth via Runx2 regulating RANKL/OPG system.
24780728 2014 The effect of dried plum on serum levels of receptor activator of NF-?B ligand, osteoprotegerin and sclerostin in osteopenic postmenopausal women: a randomised controlled trial.
24769277 2014 Changes in serum RANKL and OPG with sexual development and their associations with bone turnover and bone mineral density in a cohort of girls.
24763700 2014 New variants including ARG1 polymorphisms associated with C-reactive protein levels identified by genome-wide association and pathway analysis.
24729980 2014 Polymorphisms in the RANK/RANKL genes and their effect on bone specific prognosis in breast cancer patients.
24726460 2014 Targeting receptor-activator of nuclear kappaB ligand in aneurysmal bone cysts: verification of target and therapeutic response.
24721487 2014 Plasma osteoprotegerin levels are determined by primary cardiovascular events in late middle-aged but not in young elderly male subjects.
24719884 2014 RANKL expression in periodontal disease: where does RANKL come from?
24710939 2014 Influences of IL-6R antibody on PMMA bone cement-mediated expression of OPG and RANKL in synovial fibroblasts.
24664887 2014 PTX3 stimulates osteoclastogenesis by increasing osteoblast RANKL production.
24574213 2014 Reciprocal activation of CD4+ T cells and synovial fibroblasts by stromal cell-derived factor 1 promotes RANKL expression and osteoclastogenesis in rheumatoid arthritis.
24557630 2015 A significant induction of neutrophilic chemoattractants but not RANKL in synoviocytes stimulated with interleukin 17.
24533935 2014 Regulation and function of Rankl in arterial calcification.
24531425 2014 Prediction of subclinical atherosclerosis by serum osteoprotegerin in premenopausal women with systemic lupus erythematous: correlation of osteoprotegerin with monocyte chemotactic protein-1.
24488413 2014 Independent relationship of osteoprotegerin concentrations with endothelial activation and carotid atherosclerosis in patients with severe rheumatoid arthritis.
24478054 2014 RANK- and c-Met-mediated signal network promotes prostate cancer metastatic colonization.
24448976 2014 Nuclear factor-kappa B ligand and osteoprotegerin levels in serum and gingival crevicular fluid in patients with bone metastases treated with zoledronic acid.
24442994 2014 Association of receptor activator of nuclear factor-kappaB ligand (RANKL) gene polymorphisms with the susceptibility to ankylosing spondylitis: a case-control study.
24326209 2014 Serum sRANKL/OPG predict recurrence after radiofrequency catheter ablation of lone atrial fibrillation.
24307429 2014 Serum levels of fetuin-A, osteoprotegerin and osteopontin in patients with coronary artery disease: effects of statin (HMGCoA-reductase inhibitor) therapy.
24296448 Serum concentrations of sclerostin and bone turnover markers in children with cow's milk allergy.
24277958 2013 Bone turnover markers, osteoprotegerin and RANKL cytokines in children with cystic fibrosis.
24272640 2014 RANK expression on breast cancer cells promotes skeletal metastasis.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
24200492 2014 Expression profile of osteoprotegerin, RANK and RANKL genes in the femoral head of patients with avascular necrosis.
24161214 2013 IGF-I increases markers of osteoblastic activity and reduces bone resorption via osteoprotegerin and RANK-ligand.
24127173 2014 Novel genetic models of osteoporosis by overexpression of human RANKL in transgenic mice.
24066029 2013 Convergent RANK- and c-Met-mediated signaling components predict survival of patients with prostate cancer: an interracial comparative study.
24048682 2013 Osteoprotegerin exerts its pro-inflammatory effects through nuclear factor-?B activation.
24040204 2013 TRAIL-deficiency accelerates vascular calcification in atherosclerosis via modulation of RANKL.
23990468 2013 The paired-box homeodomain transcription factor Pax6 binds to the upstream region of the TRAP gene promoter and suppresses receptor activator of NF-?B ligand (RANKL)-induced osteoclast differentiation.
23971629 2013 Adiponectin receptors are present in RANK-L-induced multinucleated osteoclast-like cells.
23959668 2013 Age and gender predict OPG level and OPG/sRANKL ratio in maintenance hemodialysis patients.
23915851 2013 Association between single nucleotide polymorphisms of the estrogen receptor 1 and receptor activator of nuclear factor kappa B ligand genes and bone mineral density in postmenopausal Taiwanese.
23869610 2013 Substance P enhanced titanium particles-induced RANKL expression in fibroblasts from periprosthetic membrane.
23856613 2013 The relationship between osteoprotegerin gene polymorphisms and bone mineral density in Chinese postmenopausal women.
23845465 2013 The metastatic behavior of osteosarcoma by gene expression and cytogenetic analyses.
23762088 2013 RANKL cytokine: from pioneer of the osteoimmunology era to cure for a rare disease.
23756197 2013 Oxidized low density lipoprotein enhanced RANKL expression in human osteoblast-like cells. Involvement of ERK, NFkappaB and NFAT.
23752595 2013 Assessment of the relationship between melatonin, hormones of the pituitary-ovarian, -thyroid and -adrenocortical axes, and osteoprotegerin and its ligand sRANKL in girls with anorexia nervosa.
23744843 2013 Analyses of RANK and RANKL in the post-GWAS context: functional evidence of vitamin D stimulation through a RANKL distal region.
23710898 2014 Effects of Enterococcus faecalis lipoteichoic acid on receptor activator of nuclear factor-?B ligand and osteoprotegerin expression in periodontal ligament fibroblasts.
23710436 2013 1,25-dihydroxyvitamin D3 inhibits the RANKL pathway and impacts on the production of pathway-associated cytokines in early rheumatoid arthritis.
23702841 2013 RANK/RANK-L/OPG in patients with bone metastases treated with anticancer agents and zoledronic acid: a prospective study.
23698708 Activated human T cells express alternative mRNA transcripts encoding a secreted form of RANKL.
23697850 2013 RANKL promotes the growth of decidual stromal cells in an autocrine manner via CCL2/CCR2 interaction in human early pregnancy.
23677868 2013 Siglec-15 regulates osteoclast differentiation by modulating RANKL-induced phosphatidylinositol 3-kinase/Akt and Erk pathways in association with signaling Adaptor DAP12.
23666878 2013 Osteoprotegerin causes apoptosis of endothelial progenitor cells by induction of oxidative stress.
23612487 2013 Sphingosine-1-phosphate promotes the nuclear translocation of ?-catenin and thereby induces osteoprotegerin gene expression in osteoblast-like cell lines.
23600327 2013 Expression of RANKL and proliferation abilities of cultured human middle ear cholesteatoma epithelial cells.
23549459 2013 Maxillary sinus augmentation procedures through equine-derived biomaterial or calvaria autologous bone: immunohistochemical evaluation of OPG/RANKL in humans.
23531404 2013 Association of genetic polymorphisms of RANK, RANKL and OPG with bone mineral density in Chinese peri- and postmenopausal women.
23521017 2013 Expression of Toll-like receptors 2 and 4 and the OPG-RANKL-RANK system in inflammatory external root resorption and external cervical resorption.
23516466 2013 Differential expression of the RANKL/RANK/OPG system is associated with bone metastasis in human non-small cell lung cancer.
23509146 2013 Brucella abortus invasion of synoviocytes inhibits apoptosis and induces bone resorption through RANKL expression.
23499553 2013 RANKL synthesized by both stromal cells and cancer cells plays a crucial role in osteoclastic bone resorption induced by oral cancer.
23457386 2013 RANKL/OPG ratio and DKK-1 expression in primary osteoblastic cultures from osteoarthritic and osteoporotic subjects.
23440406 2013 The role of the serum RANKL/OPG ratio in the healing of intertrochanteric fractures in elderly patients.
23439434 2013 CXCL5 stimulation of RANK ligand expression in Paget's disease of bone.
23437003 2013 Genetic determinants of trabecular and cortical volumetric bone mineral densities and bone microstructure.
23404437 2013 Bone metastases in gastric cancer follow a RANKL-independent mechanism.
23396210 2013 Blockade of receptor activator of nuclear factor-?B (RANKL) signaling improves hepatic insulin resistance and prevents development of diabetes mellitus.
23336103 2013 Assessment and clinical implications of RANK/RANKL/OPG pathway as markers of bone tumor progression in patients with NET harboring bone metastases.
23329761 2012 Single-nucleotide polymorphism of the osteoprotegerin gene and its association with bone mineral density in Chinese postmenopausal women.
23267146 2013 Expression profile of receptor activator of nuclear-?B (RANK), RANK ligand (RANKL) and osteoprotegerin (OPG) in breast cancer.
23244167 2013 MSRA polymorphism is associated with the risk of rheumatoid arthritis in a Chinese population.
23241893 2013 Receptor activator for NF-?B ligand in acute myeloid leukemia: expression, function, and modulation of NK cell immunosurveillance.
23190522 2012 Serum receptor activator of nuclear factor-? B ligand, osteoprotegrin, and intact parathyroid hormone in hemodialysis and renal transplant patients.
23183242 2013 Protein phosphatase 2A C? is involved in osteoclastogenesis by regulating RANKL and OPG expression in osteoblasts.
23178378 2013 Immunomodulatory drugs lenalidomide and pomalidomide inhibit multiple myeloma-induced osteoclast formation and the RANKL/OPG ratio in the myeloma microenvironment targeting the expression of adhesion molecules.
23177932 2013 Analysis of RANKL gene polymorphism (rs9533156 and rs2277438) in Iranian patients with chronic periodontitis and periimplantitis.
23176170 2013 Role of GSH/GSSG redox couple in osteogenic activity and osteoclastogenic markers of human osteoblast-like SaOS-2 cells.
23139212 2013 RANKL expression, function, and therapeutic targeting in multiple myeloma and chronic lymphocytic leukemia.
23077504 2012 Inhibition of BDNF in multiple myeloma blocks osteoclastogenesis via down-regulated stroma-derived RANKL expression both in vitro and in vivo.
23018352 2012 Correlation of plasma osteoprotegerin (OPG) and receptor activator of the nuclear factor ?B ligand (RANKL) levels with clinical risk factors in patients with advanced carotid atherosclerosis.
22989723 2013 Oral squamous carcinoma cells secrete RANKL directly supporting osteolytic bone loss.
22955577 2012 IL-1? and compressive forces lead to a significant induction of RANKL-expression in primary human cementoblasts.
22952578 2012 Soluble rank ligand produced by myeloma cells causes generalised bone loss in multiple myeloma.
22936827 2012 Elevated levels of the mediator of catabolic bone remodeling RANKL in the bone marrow environment link chronic heart failure with osteoporosis.
22929916 2012 Bone metastasis in breast cancer: the story of RANK-ligand.
22867712 2012 Rheumatoid and pyrophosphate arthritis synovial fibroblasts induce osteoclastogenesis independently of RANKL, TNF and IL-6.
22848465 2012 Receptor activator of NF-kappaB and podocytes: towards a function of a novel receptor-ligand pair in the survival response of podocyte injury.
22792071 2012 WNT16 influences bone mineral density, cortical bone thickness, bone strength, and osteoporotic fracture risk.
22753650 2012 RANK-RANKL-OPG in hemophilic arthropathy: from clinical and imaging diagnosis to histopathology.
22715006 2013 Alterations of the RANKL pathway in blood and bone marrow samples of prostate cancer patients without bone metastases.
22709525 2012 RANKL synthesized by articular chondrocytes contributes to juxta-articular bone loss in chronic arthritis.
22705116 2012 New insights into osteoclastogenic signaling mechanisms.
22704876 2013 Osteoprotegerin in ST-elevation myocardial infarction: prognostic impact and association with markers of myocardial damage by magnetic resonance imaging.
22698523 2012 No influence of OPG and its ligands, RANKL and TRAIL, on proliferation and regulation of the calcification process in primary human vascular smooth muscle cells.
22664871 2012 Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin.
22640692 2013 Serum osteoprotegerin and osteopontin levels are associated with arterial stiffness and the presence and severity of coronary artery disease.
22634178 2012 Effects of 17?-estradiol on adiponectin regulation of the expression of osteoprotegerin and receptor activator of nuclear factor-?B ligand.
22627031 2012 RANKL in the osteolysis of AES total ankle replacement implants.
22592030 2012 Circulating osteoprotegerin and Dickkopf-1 changed significantly after surgical aortic valve replacement but remained without any significant differences after transcatheter aortic valve implantation.
22556124 2012 Selective regulation of osteoblastic OPG and RANKL by dehydroepiandrosterone through activation of the estrogen receptor ?-mediated MAPK signaling pathway.
22546829 2012 Association between OPG, RANK and RANKL gene polymorphisms and susceptibility to acute coronary syndrome in Korean population.
22531921 2012 Human polymorphonuclear neutrophils express RANK and are activated by its ligand, RANKL.
22490874 2012 Osteoprotegerin/RANKL axis and progression of coronary artery calcification in hemodialysis patients.
22402034 2012 Role of the OPG/RANK/RANKL triad in calcifications of the atheromatous plaques: comparison between carotid and femoral beds.
22330139 2013 CXCL13 activation of c-Myc induces RANK ligand expression in stromal/preosteoblast cells in the oral squamous cell carcinoma tumor-bone microenvironment.
22326262 2012 Sphingosine 1-phosphate (S1P)/S1P receptor 1 signaling regulates receptor activator of NF-?B ligand (RANKL) expression in rheumatoid arthritis.
22278625 2012 Osteoprotegerin, but not osteopontin, as a potential predictor of vascular calcification in normotensive subjects.
22278426 2012 Serum osteoprotegerin, RANKL, and Dkk-1 levels in adults with Langerhans cell histiocytosis.
22268274 2011 Serum osteoprotegerin correlates with age and bone mass in postmenopausal, but not in fertile age women.
22242921 2012 In vitro stoichiometry of complexes between the soluble RANK ligand and the monoclonal antibody denosumab.
22214279 2012 Immunohistochemical expression of RANKL, RANK and OPG in gingival tissue of patients with periodontitis.
22207352 2012 Role of DNA methylation in the regulation of the RANKL-OPG system in human bone.
22185226 2011 "Single nucleotide polymorphisms of the OPG/RANKL system genes in primary hyperparathyroidism and their relationship with bone mineral density".
22178057 2013 Osteoprotegerin/RANK/RANKL axis and atrial remodeling in mitral valvular patients with atrial fibrillation.
22176920 2011 Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis.
22172512 2012 Depth and volume of resorption induced by osteoclasts generated in the presence of RANKL, TNF-alpha/IL-1 or LIGHT.
22120987 2012 Alteration of Dickkopf-1 and receptor activator of nuclear factor-?B ligand during PBSC mobilization in healthy donors by G-CSF.
22119834 2011 The OPG/RANKL system and zinc ions are promoters of bone remodeling by osteoblast proliferation in postmenopausal osteoporosis.
22116393 2012 Receptor activator of NF- ?B ligand (RANKL) increases the release of neutrophil products associated with coronary vulnerability.
22102368 2012 PTHrP increases RANKL expression by stromal cells from giant cell tumor of bone.
22053710 2012 Tumor necrosis factor-? and receptor activator of nuclear factor-?B ligand augment human macrophage foam-cell destruction of extracellular matrix through protease-mediated processes.
22049226 2012 Receptor activator for nuclear factor ? B expression predicts poor prognosis in breast cancer patients with bone metastasis but not in patients with visceral metastasis.
22034880 2011 Infantile haemangioma expresses tumour necrosis factor-related apoptosis-inducing ligand (TRAIL), TRAIL receptors, osteoprotegerin and receptor activator for nuclear factor ?B ligand (RANKL).
22027240 2011 Soluble receptor activator of nuclear factor ?B ligand/osteoprotegerin ratio is increased in systemic lupus erythematosus patients.
22025323 2012 Cobalt and chromium ions reduce human osteoblast-like cell activity in vitro, reduce the OPG to RANKL ratio, and induce oxidative stress.
22023082 2012 Association analyses suggest the effects of RANK and RANKL on age at menarche in Chinese women.
22001292 2011 Dysregulated atrial gene expression of osteoprotegerin/receptor activator of nuclear factor-?B (RANK)/RANK ligand axis in the development and progression of atrial fibrillation.
22001124 2012 RANKL/RANK/OPG system and bone status in females with anorexia nervosa.
21992185 2011 Bone destruction by receptor activator of nuclear factor ?B ligand-expressing T cells in chronic gouty arthritis.
21991382 2011 Sclerostin stimulates osteocyte support of osteoclast activity by a RANKL-dependent pathway.
21970938 2011 Identifying coronary artery disease in men with type 2 diabetes: osteoprotegerin, pulse wave velocity, and other biomarkers of cardiovascular risk.
21964949 2011 Influence of polymorphisms in the RANKL/RANK/OPG signaling pathway on volumetric bone mineral density and bone geometry at the forearm in men.
21963155 2011 Primary human bone marrow adipocytes support TNF-?-induced osteoclast differentiation and function through RANKL expression.
21941412 2011 Angiogenesis-related cytokines, RANKL, and osteoprotegerin in multiple myeloma patients in relation to clinical features and response to treatment.
21903860 2011 The skeleton: a multi-functional complex organ: the role of key signalling pathways in osteoclast differentiation and in bone resorption.
21880134 2011 Constitutive expression of cathepsin K in the human intervertebral disc: new insight into disc extracellular matrix remodeling via cathepsin K and receptor activator of nuclear factor-?B ligand.
21868322 2011 [Influence of surface modification of titanium on OPG/RANKL mRNA expression in MG-63 human osteoblast-like cells].
21850548 2011 Relationship between serum RANKL and RANKL in bone.
21814026 2011 [Central regulation of body temperature by RANKL/RANK pathway].
21814025 2011 [Regulation of central tolerance by RANKL signaling].
21814024 2011 [RANKL signaling and bone diseases. Quiescent osteoclast precursors and RANKL signaling].
21814023 2011 [In vivo imaging of mature osteoclasts and RANKL signaling].
21814022 2011 [RANKL/RANK signaling in rheumatoid arthritis].
21814021 2011 [Myeloma bone disease and RANKL signaling].
21814020 2011 [Involvement of RANKL/RANK pathway in bone metastasis in breast cancer].
21814019 2011 [Osteoporosis and RANKL signal].
21814018 2011 [Suppressive effects for osteoclastogenesis regulated by RANKL signal].
21814016 2011 [Control of bone resorption by RANKL-RANK system].
21810381 2011 Elevated serum receptor activator of nuclear factor kappa B ligand and osteoprotegerin levels in late-onset male hypogonadism.
21802729 2011 Increased RANKL and IL-6 levels might result in high bone turnover in a case of a CD34+/CD117+/myeloperoxidase(+dim) acute myeloid leukemia presenting with severe hypercalcemia and lumbar spine fractures.
21777519 2011 Tumor necrosis factor-? converting enzyme (TACE) increases RANKL expression in osteoblasts and serves as a potential biomarker of periodontitis.
21748518 2011 Osteoprotegerin (OPG) and related proteins (RANK, RANKL and TRAIL) in thyroid disease.
21742767 2011 A comprehensive manually curated reaction map of RANKL/RANK-signaling pathway.
21725611 2011 RANKL-induced migration of MDA-MB-231 human breast cancer cells via Src and MAPK activation.
21708014 2011 Potential role and mechanism of IFN-gamma inducible protein-10 on receptor activator of nuclear factor kappa-B ligand (RANKL) expression in rheumatoid arthritis.
21692859 2011 Tissue microarray analysis of RANKL in cutaneous lupus erythematosus and psoriasis.
21649792 2011 Serum osteoprotegerin measurement for early diagnosis of chronic kidney disease-mineral and bone disorder.
21643971 2011 The role of RANK/RANKL/OPG signalling pathways in osteoclastogenesis in odontogenic keratocysts, radicular cysts, and ameloblastomas.
21565793 2011 Cortical bone status is associated with serum osteoprotegerin concentration in men: the STRAMBO study.
21561598 2011 RANKL expression specifically observed in vivo promotes epithelial mesenchymal transition and tumor progression.
21547906 2011 Ewing sarcoma cells express RANKL and support osteoclastogenesis.
21533022 2011 Genome-wide association study using extreme truncate selection identifies novel genes affecting bone mineral density and fracture risk.
21514280 2011 Hypoxia induces RANK and RANKL expression by activating HIF-1? in breast cancer cells.
21479768 2011 Serum osteoprotegerin, RANKL and fibroblast growth factor-23 in children with chronic kidney disease.
21479680 2011 Paracrine-mediated osteoclastogenesis by the osteosarcoma MG63 cell line: is RANKL/RANK signalling really important?
21474331 2011 The RANKL-OPG system is differentially regulated by supragingival and subgingival biofilm supernatants.
21413932 2011 RANKL induces NFATc1 acetylation and stability via histone acetyltransferases during osteoclast differentiation.
21401926 2011 Macrophage migration inhibitory factor enhances osteoclastogenesis through upregulation of RANKL expression from fibroblast-like synoviocytes in patients with rheumatoid arthritis.
21371424 2011 Crystallizing nanoparticles derived from vascular smooth muscle cells contain the calcification inhibitor osteoprotegerin.
21370405 2011 RANKL expression is related to treatment outcome of patients with localized, high-grade osteosarcoma.
21359671 2011 In peripubertal girls, artistic gymnastics improves areal bone mineral density and femoral bone geometry without affecting serum OPG/RANKL levels.
21352301 2011 Genetic variations in the genes encoding receptor activator nuclear factor ? B (RANK), receptor activator nuclear factor ? B ligand (RANKL) and osteoprotegerin (OPG) in patients with psoriasis and psoriatic arthritis: a case-control study.
21331661 2011 Serum osteoprotegerin levels are related to height loss: the Tromsø Study.
21328467 2011 RANKL increases migration of human lung cancer cells through intercellular adhesion molecule-1 up-regulation.
21328055 2012 Receptor activator of nuclear factor kappa B ligand serum and synovial fluid level. A comparative study between rheumatoid arthritis and osteoarthritis.
21327765 2011 Reduced osteoclastogenesis and RANKL expression in marrow from women taking alendronate.
21327451 2011 Significance of serum osteoprotegerin and receptor activator of nuclear factor ?B ligand in Japanese prostate cancer patients with bone metastasis.
21326202 2011 Tumour-infiltrating regulatory T cells stimulate mammary cancer metastasis through RANKL-RANK signalling.
21316442 2011 Effects of resistance and aerobic exercise on physical function, bone mineral density, OPG and RANKL in older women.
21290130 2012 Involvement of soluble receptor activator of nuclear factor-?B ligand (sRANKL) in collagenase-induced murine osteoarthritis and human osteoarthritis.
21259010 2012 The expression of RANKL and OPG in the various grades of osteoarthritic cartilage.
21193069 2011 RANKL-independent human osteoclast formation with APRIL, BAFF, NGF, IGF I and IGF II.
21159831 2011 Radiographic bone damage in chronic gout is negatively associated with the inflammatory cytokines soluble interleukin 6 receptor and osteoprotegerin.
21124946 2010 Genome-wide association meta-analysis of cortical bone mineral density unravels allelic heterogeneity at the RANKL locus and potential pleiotropic effects on bone.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21087777 2011 Similar to adiponectin, serum levels of osteoprotegerin are associated with obesity in healthy subjects.
21074311 2011 Maternal circulating osteoprotegerin and soluble RANKL in pre-eclamptic women.
20974615 2011 Osteoprotegerin genetic polymorphisms and age of symptom onset in ankylosing spondylitis.
20932948 2011 Adipokines, bone-derived factors and bone turnover in obese children; evidence for altered fat-bone signalling resulting in reduced bone mass.
20890036 2010 [Cytokines in bone diseases. Genetic disorders of RANKL-RANK-OPG system].
20881963 2010 RANK ligand mediates progestin-induced mammary epithelial proliferation and carcinogenesis.
20861651 2011 Serum osteoprotegerin is a predictor of progression of atherosclerosis and coronary calcification in hemodialysis patients.
20848544 2011 Osteoprotegerin in pediatric Crohn's disease and the effects of exclusive enteral nutrition.
20718662 2010 The clinical significance of OPG/sRANKL ratio in thalassemia patients suffering from osteopenia or osteoporosis in Egyptian patients.
20690034 2010 Soluble receptor activator of nuclear factor-kappaB ligand (RANKL) and osteoprotegerin in ankylosing spondylitis: OPG is associated with poor physical mobility and reflects systemic inflammation.
20663885 2010 PKA-induced receptor activator of NF-kappaB ligand (RANKL) expression in vascular cells mediates osteoclastogenesis but not matrix calcification.
20631064 2010 Receptor activator of NF-kappaB ligand enhances breast cancer-induced osteolytic lesions through upregulation of extracellular matrix metalloproteinase inducer/CD147.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20554715 2010 Analysis of recently identified osteoporosis susceptibility genes in Han Chinese women.
20534768 2010 OPG and RANK polymorphisms are both associated with cortical bone mineral density: findings from a metaanalysis of the Avon longitudinal study of parents and children and gothenburg osteoporosis and obesity determinants cohorts.
20533289 2010 A functional RANKL polymorphism associated with younger age at onset of rheumatoid arthritis.
20531232 TNFRSF11A and TNFSF11 are associated with age at menarche and natural menopause in white women.
20506523 2010 Involvement of integrin up-regulation in RANKL/RANK pathway of chondrosarcomas migration.
20506157 2010 The increased expression of receptor activator of nuclear-kappaB ligand (RANKL) of multiple myeloma bone marrow stromal cells is inhibited by the bisphosphonate ibandronate.
20431232 2010 The relationship between Receptor Activator of Nuclear Factor-kappaB Ligand (RANKL) gene polymorphism and aortic calcification in Korean women.
20416172 2010 [Significance of sRANKL/OPG ratio in diagnosis of multiple myeloma bone disease].
20412401 2010 The role of RANKL and MMP-9 in the bone resorption caused by ameloblastoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20333869 2009 Relationships between osteoprotegerin (OPG), receptor activator of nuclear factor kappaB ligand (RANKL), and growth hormone (GH) secretory status in short children.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20231205 2010 Genetic variations in genes encoding RANK, RANKL, and OPG in rheumatoid arthritis: a case-control study.
20225273 2010 CCAAT/enhancer binding protein beta is up-regulated in giant cell tumor of bone and regulates RANKL expression.
20205168 2010 Genetic variation in the RANKL/RANK/OPG signaling pathway is associated with bone turnover and bone mineral density in men.
20167120 2010 Interleukin-17A upregulates receptor activator of NF-kappaB on osteoclast precursors.
20157786 2010 Dysregulation of the receptor activator of NF-kappaB ligand and osteoprotegerin production influence the apoptosis of multiple myeloma patients' bone marrow stromal cells co-cultured with myeloma cells.
20084381 2010 Increased osteoclastic activity as shown by increased sRANK-L/OPG ratio in boys with hemophilia.
20066901 2009 VEGF165 promotes the osteolytic bone destruction of ewing's sarcoma tumors by upregulating RANKL.
20033478 2010 RANKL and OPG mRNA level after non-surgical periodontal treatment.
19967657 Inflammation modifies the association of osteoprotegerin with mortality in chronic kidney disease.
19940926 2009 Central control of fever and female body temperature by RANKL/RANK.
19934266 2010 Allelic variations of RANKL/OPG signaling system are related to bone mineral density and in vivo gene expression.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19896533 2010 Gene-gene interactions in RANK/RANKL/OPG system influence bone mineral density in postmenopausal women.
19877052 2009 A novel T cell cytokine, secreted osteoclastogenic factor of activated T cells, induces osteoclast formation in a RANKL-independent manner.
19847430 2010 Synovial tissue rank ligand expression and radiographic progression in rheumatoid arthritis: observations from a proof-of-concept randomized clinical trial of cytokine blockade.
19810098 2010 Titanium uptake, induction of RANK-L expression, and enhanced proliferation of human T-lymphocytes.
19793762 2010 Persistent increase of osteoprotegerin levels after cortisol normalization in patients with Cushing's syndrome.
19781765 2010 Over-expression of receptor activator of nuclear factor-kappaB ligand (RANKL), inflammatory cytokines, and chemokines in periprosthetic osteolysis of loosened total hip arthroplasty.
19716455 2010 Control of RANKL gene expression.
19705167 2009 Association between osteoprotegerin gene polymorphism and bone mineral density in patients with adolescent idiopathic scoliosis.
19699688 2009 Oxidized lipids enhance RANKL production by T lymphocytes: implications for lipid-induced bone loss.
19671684 2009 A novel function of CXCL13 to stimulate RANK ligand expression in oral squamous cell carcinoma cells.
19662974 2009 [Osteoprotegerin and receptor activator of nuclear factor kappa B ligand mRNAs expression in BMSCs of glucocorticoid-induced necrosis of the femoral head patients].
19633200 2009 ADA-deficient SCID is associated with a specific microenvironment and bone phenotype characterized by RANKL/OPG imbalance and osteoblast insufficiency.
19556344 2009 FGF-2 stimulation of RANK ligand expression in Paget's disease of bone.
19554506 2009 Expression of eight genes of nuclear factor-kappa B pathway in multiple myeloma using bone marrow aspirates obtained at diagnosis.
19548455 2009 [Polymorphism of osteoprotegerin gene and osteoporosis in postmenopausal women].
19546479 2009 Surface RANKL of Toll-like receptor 4-stimulated human neutrophils activates osteoclastic bone resorption.
19502537 2009 Association between osteoprotegerin G1181C and T245G polymorphisms and diabetic charcot neuroarthropathy: a case-control study.
19473572 Receptor activator of nuclear factor kappa B ligand in an experimental intervertebral disc degeneration.
19458885 2009 Association analyses of RANKL/RANK/OPG gene polymorphisms with femoral neck compression strength index variation in Caucasians.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19449178 2009 Passage-affected competitive regulation of osteoprotegerin synthesis and the receptor activator of nuclear factor-kappaB ligand mRNA expression in normal human osteoblasts stimulated by the application of cyclic tensile strain.
19446344 2009 TLR-3 enhances osteoclastogenesis through upregulation of RANKL expression from fibroblast-like synoviocytes in patients with rheumatoid arthritis.
19416721 2009 The affinity of human RANK binding to its ligand RANKL.
19415676 2009 Direct inhibitory and indirect stimulatory effects of RAGE ligand S100 on sRANKL-induced osteoclastogenesis.
19401376 2009 Osteoclastogenesis in children with 21-hydroxylase deficiency on long-term glucocorticoid therapy: the role of receptor activator of nuclear factor-kappaB ligand/osteoprotegerin imbalance.
19379170 2009 Regulatory effect of parathyroid hormone on sRANKL-osteoprotegerin in hemodialysis patients with renal bone disease.
19352306 2009 Osteoprotegerin and RANKL in the pathogenesis of osteoporosis in patients with thalassaemia major.
19325145 2009 Osteoprotegerin and soluble receptor activator of nuclear factor-kappaB ligand and risk for coronary events: a nested case-control approach in the prospective EPIC-Norfolk population study 1993-2003.
19299513 2009 Trolox prevents osteoclastogenesis by suppressing RANKL expression and signaling.
19299182 2009 Gene polymorphisms and osteoporotic fractures: a study in postmenopausal French women.
19298221 2009 The upregulation of receptor activator NF-kappaB ligand expression by interleukin-1alpha and Porphyromonas endodontalis in human osteoblastic cells.
19190327 2009 Zerumbone abolishes RANKL-induced NF-kappaB activation, inhibits osteoclastogenesis, and suppresses human breast cancer-induced bone loss in athymic nude mice.
19185505 2009 Role of RANKL in bone diseases.
19170075 2009 Prostate cancer promotes CD11b positive cells to differentiate into osteoclasts.
19158438 2009 Implications of measuring soluble receptor activators of nuclear factor-kappaB ligand and osteoprotegerin in bone metabolism of elderly women.
19134349 2008 [Effects of calcitriol on the expression of vitamin D receptor, RANKL and osteoprotegerin in human periodontal ligament cells].
19131500 2009 The combinations of polymorphisms in vitamin D receptor, osteoprotegerin and tumour necrosis factor superfamily member 11 genes are associated with bone mineral density.
19112497 2008 TRAF6 autoubiquitination-independent activation of the NFkappaB and MAPK pathways in response to IL-1 and RANKL.
19105036 2009 Osteoprotegerin and RANKL differentially regulate angiogenesis and endothelial cell function.
19085839 2009 Receptor activator of nuclear factor-kappa B ligand (RANKL) stimulates bone-associated tumors through functional RANK expressed on bone-associated cancer cells?
19079262 2009 New sequence variants associated with bone mineral density.
19073256 2009 RANKL/OPG in primary cultures of osteoblasts from post-menopausal women. Differences between osteoporotic hip fractures and osteoarthritis.
19058836 2010 Soluble TRAIL could enhance bone destruction acting on Rank-ligand in estrogen-independent human breast cancer cell line MDA-MB-231.
19058084 2009 Expression of RANK-ligand in prostate cancer cell lines.
19008470 2009 Dysregulated RANK ligand/RANK axis in hyperhomocysteinemic subjects: effect of treatment with B-vitamins.
18928898 2008 Expression of bone resorption regulators (RANK, RANKL, and OPG) in odontogenic tumors.
18802807 Osteoprotegerin/RANKL system imbalance in active polyarticular-onset juvenile idiopathic arthritis: a bone damage biomarker?
18767923 2009 Inhibition of lamin A/C attenuates osteoblast differentiation and enhances RANKL-dependent osteoclastogenesis.
18754324 2008 Cytolethal distending toxin upregulates RANKL expression in Jurkat T-cells.
18727653 2008 Saliva concentrations of RANKL and osteoprotegerin in smoker versus non-smoker chronic periodontitis patients.
18710934 2008 The association of Notch2 and NF-kappaB accelerates RANKL-induced osteoclastogenesis.
18668542 2008 Cytokine-controlled RANKL and osteoprotegerin expression by human and mouse synovial fibroblasts: fibroblast-mediated pathologic bone resorption.
18645583 2008 Receptor activator of NF-kappaB Ligand (RANKL) expression is associated with epithelial to mesenchymal transition in human prostate cancer cells.
18634923 2008 Differential patterns of receptor activator of nuclear factor kappa B ligand/osteoprotegerin expression in human periapical granulomas: possible association with progressive or stable nature of the lesions.
18617513 2008 The RING domain and first zinc finger of TRAF6 coordinate signaling by interleukin-1, lipopolysaccharide, and RANKL.
18606662 2008 Epidermal receptor activator of NF-kappaB ligand controls Langerhans cells numbers and proliferation.
18606301 2008 Human osteoclast-poor osteopetrosis with hypogammaglobulinemia due to TNFRSF11A (RANK) mutations.
18589796 2008 [The expression of receptor activator nuclear factor-kappaB ligand and osteoprotegerin in cholesteatoma].
18586671 2008 TSG-6 regulates bone remodeling through inhibition of osteoblastogenesis and osteoclast activation.
18565252 The differential expression of osteoprotegerin (OPG) and receptor activator of nuclear factor kappaB ligand (RANKL) in human osteoarthritic subchondral bone osteoblasts is an indicator of the metabolic state of these disease cells.
18565244 Imbalanced expression of RANKL and osteoprotegerin mRNA in pannus tissue of rheumatoid arthritis.
18556224 2008 Prolactin decreases the expression ratio of receptor activator of nuclear factor kappaB ligand/osteoprotegerin in human fetal osteoblast cells.
18539107 2008 Differential modulation of RANKL isoforms by human osteoarthritic subchondral bone osteoblasts: influence of osteotropic factors.
18528653 2008 Enhanced expression of interleukin-6, matrix metalloproteinase-13, and receptor activator of NF-kappaB ligand in cells derived from osteoarthritic subchondral bone.
18502820 2008 Tumour necrosis factor superfamily member 11 gene promoter polymorphisms modulate promoter activity and influence bone mineral density in postmenopausal women with osteoporosis.
18480302 2008 RANKL is a mediator of bone resorption in idiopathic hypercalciuria.
18445777 2008 Multiple genetic loci for bone mineral density and fractures.
18435789 2008 Formation of osteoclast-like cells from peripheral blood of periodontitis patients occurs without supplementation of macrophage colony-stimulating factor.
18406448 2008 Breast adenocarcinoma MCF-7 cell line induces spontaneous osteoclastogenesis via a RANK-ligand-dependent pathway.
18399769 2008 The effects of recombinant TSH on bone turnover markers and serum osteoprotegerin and RANKL levels.
18389210 2008 Increased osteoclastic activity in acute Charcot's osteoarthropathy: the role of receptor activator of nuclear factor-kappaB ligand.
18381203 2008 Transcriptional regulation of human RANK ligand gene expression by E2F1.
18369625 2008 Intracellular and surface RANKL are differentially regulated in patients with ankylosing spondylitis.
18367263 2008 OPG, RANK and RANK ligand expression in thyroid lesions.
18362509 2008 Circulating profiles of osteoprotegerin and soluble receptor activator of nuclear factor kappaB ligand in post-menopausal women.
18361931 2008 The clinical significance of soluble human leukocyte antigen class-I, ICTP, and RANKL molecules in multiple myeloma patients.
18319315 2008 Does osteoprotegerin or receptor activator of nuclear factor-kappaB ligand mediate the association between bone and coronary artery calcification?
18311801 2008 The abundant synovial expression of the RANK/RANKL/Osteoprotegerin system in peripheral spondylarthritis is partially disconnected from inflammation.
18305214 2008 Myeloma-derived Dickkopf-1 disrupts Wnt-regulated osteoprotegerin and RANKL production by osteoblasts: a potential mechanism underlying osteolytic bone lesions in multiple myeloma.
18301383 2008 Human circulating monocytes can express receptor activator of nuclear factor-kappaB ligand and differentiate into functional osteoclasts without exogenous stimulation.
18298349 2008 Serum levels of the osteoprotegerin, receptor activator of nuclear factor kappa-B ligand, metalloproteinase-1 (MMP-1) and tissue inhibitors of MMP-1 levels are increased in men 6 months after acute myocardial infarction.
18271850 2008 The effect of sexual hormone abnormalities on proximal femur bone mineral density in hemodialysis patients and the possible role of RANKL.
18253488 2008 cAMP/PKA regulates osteogenesis, adipogenesis and ratio of RANKL/OPG mRNA expression in mesenchymal stem cells by suppressing leptin.
18208894 2008 Receptor activator of nuclear factor kappaB ligand (RANKL) and osteoprotegerin levels in multiple sclerosis.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18172654 2008 sRANKL and OPG in serum and synovial fluid of patients with rheumatoid arthritis in comparison to non-destructive chronic arthritis.
18073309 2008 The role of the receptor activator of nuclear factor-kappaB ligand/osteoprotegerin cytokine system in primary hyperparathyroidism.
18072013 2008 Serum levels of receptor activator of nuclear factor kappaB ligand (RANKL) in healthy women and men.
18064531 2008 Inhibition of RANKL blocks skeletal tumor progression and improves survival in a mouse model of breast cancer bone metastasis.
18061491 2008 Comparative expression of RANK, RANKL, and OPG in keratocystic odontogenic tumors, ameloblastomas, and dentigerous cysts.
17993768 2007 sRANKL/osteoprotegerin complex and biochemical markers in a cohort of male and female hemodialysis patients.
17990294 2008 PTH/cAMP/PKA signaling facilitates canonical Wnt signaling via inactivation of glycogen synthase kinase-3beta in osteoblastic Saos-2 cells.
17982618 2007 Receptor activator of nuclear factor-kappaB ligand (RANKL) directly modulates the gene expression profile of RANK-positive Saos-2 human osteosarcoma cells.
17970704 2007 Circulating levels of osteoprotegerin and receptor activator of NF-kappaB ligand in patients with chronic renal failure.
17966895 2007 [The influence of sex and age on the osteoprotegerin level in the blood].
17895323 2007 CLINICAL Review #: the role of receptor activator of nuclear factor-kappaB (RANK)/RANK ligand/osteoprotegerin: clinical implications.
17891780 2008 DACH1 negatively regulates the human RANK ligand gene expression in stromal/preosteoblast cells.
17881498 2007 Specificity of RGS10A as a key component in the RANKL signaling mechanism for osteoclast differentiation.
17876645 2007 Associations between HLA-DRB1, RANK, RANKL, OPG, and IL-17 genotypes and disease severity phenotypes in Japanese patients with early rheumatoid arthritis.
17852826 2007 Biological variation and reference intervals for circulating osteopontin, osteoprotegerin, total soluble receptor activator of nuclear factor kappa B ligand and high-sensitivity C-reactive protein.
17703334 2008 Elevated serum receptor activator of NFkappaB ligand (RANKL), osteoprotegerin (OPG), matrix metalloproteinase (MMP)3, and ProMMP1 in patients with juvenile idiopathic arthritis.
17702740 2007 Investigating the interaction between osteoprotegerin and receptor activator of NF-kappaB or tumor necrosis factor-related apoptosis-inducing ligand: evidence for a pivotal role for osteoprotegerin in regulating two distinct pathways.
17667143 Association between osteoprotegerin (OPG), receptor activator of nuclear factor-kappaB (RANK), and RANK ligand (RANKL) gene polymorphisms and circulating OPG, soluble RANKL levels, and bone mineral density in Korean postmenopausal women.
17634142 2007 Role of RANKL inhibition in osteoporosis.
17634140 2007 Biology of RANK, RANKL, and osteoprotegerin.
17632511 2007 Osteoclast-poor human osteopetrosis due to mutations in the gene encoding RANKL.
17620507 2007 Soluble receptor activator of nuclear factor-kappa B ligand and risk for cardiovascular disease.
17606458 2007 Serum levels of OPG, RANKL and RANKL/OPG ratio in newly-diagnosed patients with multiple myeloma. Clinical correlations.
17593489 2007 Negative autoregulation of RANKL and c-Src signaling in osteoclasts.
17580719 2007 [Expression and significance of nuclear factor-kappa B ligand and correlation factor in the tissue of otitis media with cholesteatoma].
17572386 2007 TRAF6 ubiquitin ligase is essential for RANKL signaling and osteoclast differentiation.
17560137 2007 Expression of receptor activator of nuclear factor-kappaB ligand in synovial tissue: comparison with degradation of articular cartilage in temporomandibular joint disorders.
17558893 2007 Maintained malnutrition produces a progressive decrease in (OPG)/RANKL ratio and leptin levels in patients with anorexia nervosa.
17520299 2007 Elevated soluble receptor activator of nuclear factor-kappaB ligand and reduced bone mineral density in patients with adolescent idiopathic scoliosis.
17506059 2007 Receptor activator of nuclear factor kappa B ligand (RANKL) modulates the expression of genes involved in apoptosis and cell cycle in human osteoclasts.
17448630 2007 Regulation of RANKL and OPG gene expression in human gingival fibroblasts and periodontal ligament cells by Porphyromonas gingivalis: a putative role of the Arg-gingipains.
17331078 2007 Epistatic interactions between genomic regions containing the COL1A1 gene and genes regulating osteoclast differentiation may influence femoral neck bone mineral density.
17328075 2007 RANKL:osteoprotegerin ratio and bone mineral density in children with untreated juvenile dermatomyositis.
17328065 2007 Bradykinin potentiates cytokine-induced prostaglandin biosynthesis in osteoblasts by enhanced expression of cyclooxygenase 2, resulting in increased RANKL expression.
17288531 2007 Key roles of the OPG-RANK-RANKL system in bone oncology.
17241109 2007 Regulation and enzymatic basis of bone resorption by human osteoclasts.
17197168 2007 Multiple enhancer regions located at significant distances upstream of the transcriptional start site mediate RANKL gene expression in response to 1,25-dihydroxyvitamin D3.
17195907 2007 Receptor activator of nuclear factor-kappaB ligand (RANKL) expression in hepatocellular carcinoma with bone metastasis.
17151927 2007 RANKL-dependent and RANKL-independent mechanisms of macrophage-osteoclast differentiation in breast cancer.
17133360 2007 CCL20 chemokine induces both osteoblast proliferation and osteoclast differentiation: Increased levels of CCL20 are expressed in subchondral bone tissue of rheumatoid arthritis patients.
17053039 2007 Transcriptional control of receptor activator of nuclear factor-kappaB ligand by the protein kinase A activator forskolin and the transmembrane glycoprotein 130-activating cytokine, oncostatin M, is exerted through multiple distal enhancers.
17042716 2007 RGS12 is essential for RANKL-evoked signaling for terminal differentiation of osteoclasts in vitro.
17018528 2006 Negative regulation of osteoclastogenesis by ectodomain shedding of receptor activator of NF-kappaB ligand.
16969487 2006 Characteristic features of disseminated carcinomatosis of the bone marrow due to gastric cancer: the pathogenesis of bone destruction.
16953816 2006 Evaluation of RANK/RANKL/OPG gene polymorphisms in aggressive periodontitis.
16925460 2007 Periprosthetic osteolysis and its association with RANKL expression.
16861684 2006 Interleukin-10 inhibits gram-negative-microbe-specific human receptor activator of NF-kappaB ligand-positive CD4+-Th1-cell-associated alveolar bone loss in vivo.
16730419 2006 Association of TNFSF11 gene promoter polymorphisms with bone mineral density in postmenopausal women.
16704959 2006 Osteoporosis and osteosclerosis in sickle cell/beta-thalassemia: the role of the RANKL/osteoprotegerin axis.
16700737 2006 RANKL in human periapical granuloma: possible involvement in periapical bone destruction.
16681444 2006 Mast cells in atherosclerosis as a source of the cytokine RANKL.
16612568 2006 Substance P stimulates release of RANKL via COX-2 expression in human dental pulp cells.
16583245 2006 Genetic susceptibility to hip arthroplasty failure--association with the RANK/OPG pathway.
16572175 2006 Regulation of cancer cell migration and bone metastasis by RANKL.
16533764 2006 Prostate-specific antigen modulates genes involved in bone remodeling and induces osteoblast differentiation of human osteosarcoma cell line SaOS-2.
16522681 2006 Wnt signalling in osteoblasts regulates expression of the receptor activator of NFkappaB ligand and inhibits osteoclastogenesis in vitro.
16317958 2005 LTB4 can directly stimulate human osteoclast formation from PBMC independent of RANKL.
16270354 2006 Role of the RANKL/RANK system in the induction of interleukin-8 (IL-8) in B chronic lymphocytic leukemia (B-CLL) cells.
16249885 2006 Variation in genes involved in the RANKL/RANK/OPG bone remodeling pathway are associated with bone mineral density at different skeletal sites in men.
16240334 2006 Anti-RANKL therapy for inflammatory bone disorders: Mechanisms and potential clinical applications.
16234249 2005 Identification of an alternatively spliced variant of Ca2+-promoted Ras inactivator as a possible regulator of RANKL shedding.
16220542 2005 IFN-gamma-producing human T cells directly induce osteoclastogenesis from human monocytes via the expression of RANKL.
16215261 2005 Functional dissection of osteoprotegerin and its interaction with receptor activator of NF-kappaB ligand.
16191370 2005 [Expression of receptor activator of NF-kappa B ligand and osteoprotegerin protein in the giant cell lesions of jaw].
16144909 2005 Malignant B-lymphoid cells with bone lesions express receptor activator of nuclear factor-kappaB ligand and vascular endothelial growth factor to enhance osteoclastogenesis.
16143421 2005 The RANKL/OPG system and bone mineral density in patients with chronic liver disease.
16133687 2005 Regulation of synthesis of osteoprotegerin and soluble receptor activator of nuclear factor-kappaB ligand in normal human osteoblasts via the p38 mitogen-activated protein kinase pathway by the application of cyclic tensile strain.
16109714 2005 Nuclear factor of activated T cells c1 induces osteoclast-associated receptor gene expression during tumor necrosis factor-related activation-induced cytokine-mediated osteoclastogenesis.
16052586 2005 RANK and RANKL expression as markers of dendritic cell-T cell interactions in paired samples of rheumatoid synovium and lymph nodes.
15972386 2005 RANK ligand and TNF-alpha mediate acid-induced bone calcium efflux in vitro.
15894268 2005 MMP-7 promotes prostate cancer-induced osteolysis via the solubilization of RANKL.
15794927 2005 Megakaryocytes modulate osteoblast synthesis of type-l collagen, osteoprotegerin, and RANKL.
15732858 2004 Levels of cytokine receptor activator of nuclear factor kappaB ligand in gingival crevicular fluid in untreated chronic periodontitis patients.
15731115 2005 Reactive oxygen species stimulates receptor activator of NF-kappaB ligand expression in osteoblast.
15722361 2005 MCP-1 is induced by receptor activator of nuclear factor-{kappa}B ligand, promotes human osteoclast fusion, and rescues granulocyte macrophage colony-stimulating factor suppression of osteoclast formation.
15710592 2005 Lack of receptor activator of nuclear factor-kB ligand (RANKL) expression and functional production by human multiple myeloma cells.
15671541 2005 Expression of receptor activator of nuclear factor-kappaB is inversely correlated with metastatic phenotype in breast carcinoma.
15615497 2004 Bone cancer pain and the role of RANKL/OPG.
15615493 2004 Heritable disorders of the RANKL/OPG/RANK signaling pathway.
15613999 2005 Detection of receptor activator of NF-kappa beta ligand in apical periodontitis.
15564564 2004 Regulation of vascular calcification by osteoclast regulatory factors RANKL and osteoprotegerin.
15554353 2004 Stimulation of RANKL and inhibition of membrane-type matrix metalloproteinase-1 expression by parathyroid hormone in normal human osteoblasts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476205 2004 Interaction between RANKL and HLA-DRB1 genotypes may contribute to younger age at onset of seropositive rheumatoid arthritis in an inception cohort.
15377473 2004 The RANK/RANK ligand system is involved in interleukin-6 and interleukin-11 up-regulation by human myeloma cells in the bone marrow microenvironment.
15322748 2004 Vascular calcification and osteolysis in diabetic neuropathy-is RANK-L the missing link?
15313187 2004 Vitamin A differentially regulates RANKL and OPG expression in human osteoblasts.
15304486 2004 Essential role of p38 mitogen-activated protein kinase in cathepsin K gene expression during osteoclastogenesis through association of NFATc1 and PU.1.
15292354 2004 Localization of osteoprotegerin, tumor necrosis factor-related apoptosis-inducing ligand, and receptor activator of nuclear factor-kappaB ligand in Mönckeberg's sclerosis and atherosclerosis.
15290725 2004 Osteoprotegerin and receptor activator of nuclear factor-kappaB ligand mRNA expression in patients with rheumatoid arthritis and healthy controls.
15248232 2004 Expression and function of RANK in human monocyte chemotaxis.
15221493 2004 Localization of RANKL in osteolytic tissue around a loosened joint prosthesis.
15205949 2004 Expression of receptor activator of NF-kappaB ligand (RANKL) mRNA in human multiple myeloma cells.
15044512 2004 Identification of RANKL in osteolytic lesions of the facial skeleton.
14751235 2004 Regulation of osteoclastogenesis by three human RANKL isoforms expressed in NIH3T3 cells.
14734048 2004 Receptor activator of nuclear factor kappaB ligand and osteoprotegerin regulate aortic valve calcification.
14699143 2004 Functional role for heat shock factors in the transcriptional regulation of human RANK ligand gene expression in stromal/osteoblast cells.
12975380 2003 HIV envelope gp120-mediated regulation of osteoclastogenesis via receptor activator of nuclear factor kappa B ligand (RANKL) secretion and its modulation by certain HIV protease inhibitors through interferon-gamma/RANKL cross-talk.
12954625 2003 Beta1 integrin/focal adhesion kinase-mediated signaling induces intercellular adhesion molecule 1 and receptor activator of nuclear factor kappaB ligand on osteoblasts and osteoclast maturation.
12923331 2003 Expression of osteoprotegerin and RANK ligand in breast cancer bone metastasis.
12824189 2003 Mechanical strain differentially regulates endothelial nitric-oxide synthase and receptor activator of nuclear kappa B ligand expression via ERK1/2 MAPK.
12817763 2003 RANKL expression is related to the differentiation state of human osteoblasts.
12756027 2003 RANKL expression in a case of follicular lymphoma.
12702561 2003 Receptor activator of nuclear factor kappaB ligand plays a nonredundant role in doxorubicin-induced apoptosis.
12698202 2003 Role of RANKL-induced osteoclast formation and MMP-dependent matrix degradation in bone destruction by breast cancer metastasis.
12682046 2003 Catalytic properties of ADAM19.
12619938 2003 Cytokines, osteoprotegerin, and RANKL in vitro and histomorphometric indices of bone turnover in patients with different bone diseases.
12574344 2003 Cooperation of TNF family members CD40 ligand, receptor activator of NF-kappa B ligand, and TNF-alpha in the activation of dendritic cells and the expansion of viral specific CD8+ T cell memory responses in HIV-1-infected and HIV-1-uninfected individuals.
12564836 2002 Receptor activator for nuclear factor kappaB ligand and osteoprotegerin: regulators of bone physiology and immune responses/potential therapeutic agents and biochemical markers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469211 2003 Expression of RANKL and OPG mRNA in periodontal disease: possible involvement in bone destruction.
12393684 2002 Human myeloma cells stimulate the receptor activator of nuclear factor-kappa B ligand (RANKL) in T lymphocytes: a potential role in multiple myeloma bone disease.
12393586 2002 Long-lived immature dendritic cells mediated by TRANCE-RANK interaction.
12364326 2002 Parathyroid hormone stimulates receptor activator of NFkappa B ligand and inhibits osteoprotegerin expression via protein kinase A activation of cAMP-response element-binding protein.
12221720 2002 Regulation of osteoclast differentiation and function by receptor activator of NFkB ligand and osteoprotegerin.
12043011 2002 Immunohistochemical localization of receptor activator of nuclear factor kappaB (RANK) and its ligand (RANKL) in human deciduous teeth.
11792569 2002 Macrophage colony-stimulating factor and receptor activator NF-kappaB ligand fail to rescue osteoclast-poor human malignant infantile osteopetrosis in vitro.
11741951 2002 TNF-related activation-induced cytokine (TRANCE) induces angiogenesis through the activation of Src and phospholipase C (PLC) in human endothelial cells.
11606048 2001 RANKL induces formation of avian osteoclasts from macrophages but not from macrophage polykaryons.
10708588 2000 Cancer cells responsible for humoral hypercalcemia express mRNA encoding a secreted form of ODF/TRANCE that induces osteoclast formation.
10635328 1999 TRANCE, a TNF family member, activates Akt/PKB through a signaling complex involving TRAF6 and c-Src.
10580503 1999 Activated T cells regulate bone loss and joint destruction in adjuvant arthritis through osteoprotegerin ligand.
10224132 1999 Evidence for a role of a tumor necrosis factor-alpha (TNF-alpha)-converting enzyme-like protease in shedding of TRANCE, a TNF family member involved in osteoclastogenesis and dendritic cell survival.
9568710 1998 Osteoprotegerin ligand is a cytokine that regulates osteoclast differentiation and activation.
9520411 1998 Osteoclast differentiation factor is a ligand for osteoprotegerin/osteoclastogenesis-inhibitory factor and is identical to TRANCE/RANKL.
9396779 1997 TRANCE (tumor necrosis factor [TNF]-related activation-induced cytokine), a new TNF family member predominantly expressed in T cells, is a dendritic cell-specific survival factor.
9367155 1997 A homologue of the TNF receptor and its ligand enhance T-cell growth and dendritic-cell function.
9312132 1997 TRANCE is a novel ligand of the tumor necrosis factor receptor family that activates c-Jun N-terminal kinase in T cells.